Align Putative asparagine synthetase [glutamine-hydrolyzing] 2; EC 6.3.5.4 (uncharacterized)
to candidate WP_083800296.1 DESAC_RS13250 asparagine synthase (glutamine-hydrolyzing)
Query= curated2:Q58456 (515 letters) >NCBI__GCF_000195295.1:WP_083800296.1 Length = 641 Score = 204 bits (518), Expect = 1e-56 Identities = 149/477 (31%), Positives = 239/477 (50%), Gaps = 43/477 (9%) Query: 1 MCGINGIIRFGKEVIKEEINKMNKAIKHRGPDDEGIFIYNFKNYSIGLGHVRLAILDLSE 60 MCGI G I + E+++ KHRGPD G ++ IGL H RL+I+DLS+ Sbjct: 19 MCGIAGFISNNNNNL--ELSQAESIQKHRGPDASGCLYLQVGDWHIGLAHQRLSIIDLSD 76 Query: 61 KGHQPMGYNVDEDKIIYRDDELDRADIIIVYNGEIYNYLELK---EKFNLETETGTDTEV 117 G+QPM + IIY NGE+YNYLE++ E+ L+ + +DTEV Sbjct: 77 AGNQPMAAADGQSWIIY--------------NGEVYNYLEIRAELEQAGLQFHSTSDTEV 122 Query: 118 ILKLYNKLGFD-CVKEFNGMWAFCIFDKKKGLIFCSRDRLGVKPFYYYWDGNEFIFSSEL 176 IL G + + +FNGMWAF D + SRDR+GVKP YY++ + F+SE+ Sbjct: 123 ILAALQYWGPEKALPKFNGMWAFAYLDGPHNRLILSRDRVGVKPLYYFFSERQLYFASEI 182 Query: 177 KGILAVKEINKKENINKDAVELYFALGFIPSP-YSIYKNTFKLEARQNLIFDLDKREIRK 235 K IL + + + ++N + Y + + + + K+ A + DL + Sbjct: 183 KTILTM--VGGRFSLNYQVIGKYLLQSLLETDNQTFFAGIAKVPAAHLVEIDLASPSLSL 240 Query: 236 YY--YWELPDYKPIYDK-KKLIEEGKKLLYDAVKIRMRSDVPVGAFLSGGLDSSTVVGVM 292 + YW L +P D + +++E + L +DAV++R+RSDVP+G LSGG+DSS + M Sbjct: 241 TFKPYWRLHFAEPPNDAGEGILKEVQDLFFDAVRLRLRSDVPLGILLSGGVDSSAIAVAM 300 Query: 293 REF----TDLSKLHTFSIGFEGKYDETPYIKIVVDYFKTQHHHYY--FKERDFEELIDKY 346 ++ +L+ L ++ + ++DE+ YI IV H F+ + ++K Sbjct: 301 QQVLGPGANLNLLS--AVSRDHRFDESQYIDIVARRLDQPVHKVMLDFQPSQAFDYLEKV 358 Query: 347 SWIYDEPFGDYSGFPTYKVSEMARKF-VTVVLSGDGGDEVFGGYMTHLNGYRMDFIRK-- 403 W DEP ++ Y + + A++ +TVVLSG GGDE+ GY +L Y +R+ Sbjct: 359 CWFNDEPVYSFAVVSQYLLMQKAKELGITVVLSGQGGDELLCGYKKYLGFYIQSLLRQGH 418 Query: 404 LPKFLRVVGSKLPVKKDLNGIANLYLLKEAFRL--SLINPEEFYAESIKEDAIRPEI 458 +P L+ S ++D + + + EA R S + P+E K +PEI Sbjct: 419 IPTALKTFWSFW--RQDT--VLGQFSIMEAKRYLPSFLRPQELNIAGEKLKDFQPEI 471 Lambda K H 0.322 0.144 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 842 Number of extensions: 56 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 641 Length adjustment: 36 Effective length of query: 479 Effective length of database: 605 Effective search space: 289795 Effective search space used: 289795 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
Align candidate WP_083800296.1 DESAC_RS13250 (asparagine synthase (glutamine-hydrolyzing))
to HMM TIGR01536 (asnB: asparagine synthase (glutamine-hydrolyzing) (EC 6.3.5.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01536.hmm # target sequence database: /tmp/gapView.8795.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01536 [M=517] Accession: TIGR01536 Description: asn_synth_AEB: asparagine synthase (glutamine-hydrolyzing) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-131 423.7 0.0 7.7e-131 423.5 0.0 1.0 1 lcl|NCBI__GCF_000195295.1:WP_083800296.1 DESAC_RS13250 asparagine synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000195295.1:WP_083800296.1 DESAC_RS13250 asparagine synthase (glutamine-hydrolyzing) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 423.5 0.0 7.7e-131 7.7e-131 1 517 [] 20 563 .. 20 563 .. 0.86 Alignments for each domain: == domain 1 score: 423.5 bits; conditional E-value: 7.7e-131 TIGR01536 1 CgiagivdlkakakeeeeaikemletlahRGPDaegvwkde.keenailghrRLaiidlseg.aQPlsn 67 Cgiag++ +++++ ++++ ++hRGPDa+g+ + + + +l+h+RL+iidls++ +QP+++ lcl|NCBI__GCF_000195295.1:WP_083800296.1 20 CGIAGFISNNNNN----LELSQAESIQKHRGPDASGCLYLQvGDWHIGLAHQRLSIIDLSDAgNQPMAA 84 ********97642....34555577889********75555599****************999****** PP TIGR01536 68 ek.evvivfnGEIYNheeLreeleekGyeFetksDtEViLaayeewg.eelverLeGmFAfalwdekkg 134 ++ +++i++nGE+YN+ e+r+ele++G +F+++sDtEViLaa+++wg e+++ +++Gm+Afa++d ++ lcl|NCBI__GCF_000195295.1:WP_083800296.1 85 ADgQSWIIYNGEVYNYLEIRAELEQAGLQFHSTSDTEVILAALQYWGpEKALPKFNGMWAFAYLDGPHN 153 ***99**************************************************************** PP TIGR01536 135 elflaRDrlGikPLYyaseqgkllfaSEiKallalkeikaeldkealaelltlq.lvptektlfkevke 202 +l+l+RDr+G+kPLYy + +l+faSEiK +l++ + +l+ +++ ++l + l+++++t+f+++ + lcl|NCBI__GCF_000195295.1:WP_083800296.1 154 RLILSRDRVGVKPLYYFFSERQLYFASEIKTILTMVGGRFSLNYQVIGKYLLQSlLETDNQTFFAGIAK 222 ************************************999**********999999999*********** PP TIGR01536 203 lepakal.......dgeekleeywevekee.vkeseeelveelrelledavkkrlvadvpvgvllSGGl 263 +++a+ + + + +++ yw+++ e ++ e +e+++l+ dav+ rl++dvp+g+llSGG+ lcl|NCBI__GCF_000195295.1:WP_083800296.1 223 VPAAHLVeidlaspSLSLTFKPYWRLHFAEpPNDAGEGILKEVQDLFFDAVRLRLRSDVPLGILLSGGV 291 *****99999887666677777******996677788999***************************** PP TIGR01536 264 DSslvaaiakkeak..sevktFsigfedskdldeskaarkvadelgtehkevl..iseeevlkeleevi 328 DSs++a+ +++ + +++++ s ++ +des+++ va+ l+ ++v+ +++ ++++ le+v lcl|NCBI__GCF_000195295.1:WP_083800296.1 292 DSSAIAVAMQQVLGpgANLNLLSAVSR-DHRFDESQYIDIVARRLDQPVHKVMldFQPSQAFDYLEKVC 359 *************99999999999988.9*****************9999875227899********** PP TIGR01536 329 laleeptairasiplyllsklarekgvkVvLsGeGaDElfgGYeyfreakaeeale...lpeaselaek 394 + +ep+ a++++yll+++a+e g++VvLsG+G+DEl+ GY+++ ++ + l+ +p+a + lcl|NCBI__GCF_000195295.1:WP_083800296.1 360 WFNDEPVYSFAVVSQYLLMQKAKELGITVVLSGQGGDELLCGYKKYLGFYIQSLLRqghIPTALK---- 424 ****************************************************9999555333333.... PP TIGR01536 395 kl.........llqaklakeselkellkakl.eeelkekeelkkelkee.......seleellrldlel 446 ++ l q +++ e k++l l ++el+ e+ k+++ e +l+e + ld ++ lcl|NCBI__GCF_000195295.1:WP_083800296.1 425 TFwsfwrqdtvLGQFSIM---EAKRYLPSFLrPQELNIAGEKLKDFQPEilglsnnMTLQERQALDYQR 490 223333332223332222...333333222202333333333333333355666668889999999999 PP TIGR01536 447 llsdllr.akDrvsmahslEvRvPflDkelvelalsippelklrdgkeKvlLreaaeellPeeileR.k 513 + l ++Dr+sma+ E+R PflD +l+e ++ +pp +klr+g +K+++r+a++ lP ei +R + lcl|NCBI__GCF_000195295.1:WP_083800296.1 491 FSIPILThFEDRMSMAWARELREPFLDYRLIEKIIPLPPRYKLRHGWTKYIFRQAMAPFLPPEITWRkD 559 8877775156*********************************************************99 PP TIGR01536 514 Keaf 517 K++f lcl|NCBI__GCF_000195295.1:WP_083800296.1 560 KQGF 563 9998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (517 nodes) Target sequences: 1 (641 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 14.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory