Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_083818495.1 PYRFU_RS03905 shikimate dehydrogenase
Query= BRENDA::O27957 (269 letters) >NCBI__GCF_000223395.1:WP_083818495.1 Length = 301 Score = 174 bits (441), Expect = 2e-48 Identities = 107/276 (38%), Positives = 155/276 (56%), Gaps = 17/276 (6%) Query: 5 GVIGYPIKHSVSPAMHNAALQHEGIEGIYLAFEVKPDRLRDAVFGAKALGFRGLNVTIPF 64 G+IG+P+ S+SP +H + + G+E +YL ++V+ + V G + L G NVTIP Sbjct: 20 GLIGHPVAQSLSPVIHESVYRKVGVEAVYLLWDVEGREVHFVVEGLRNLA-NGFNVTIPH 78 Query: 65 KESVVEFVELEGEAAKIKTVNTIDLVEMVG-----YNTDVYGVKAALSGTELGGKTALVV 119 KE V + E++++ + ++ V++ G +NTDVYGV+ L G G T LV+ Sbjct: 79 KERVR--AHCDSESSEVSILGAVNTVKVEGAKLHCFNTDVYGVERCLRGLASDGFTMLVL 136 Query: 120 GAGGAGKAAALALLDMG-STVIVANRTEEKGREAVEMLRRYG---ECIFWPLSRVEELKG 175 GAGGA KAA LA +G STVI++NRT + + + G + WP R E Sbjct: 137 GAGGAAKAAVLAAQHLGASTVIISNRTRSRAVQLAGIAEALGLRARVVAWPPPR--EAIE 194 Query: 176 KVDVVVNATPLGMRGFKAEIPVPPSMLDGVELVFDTVYNPMETPLIREAKKRGCKVVYGI 235 + DV+ NATPLGM G PV + +VFD +Y P+ETPLIR A++R + V G+ Sbjct: 195 EADVLFNATPLGMEGVGGAPPVDTDAISPKHVVFDAIYKPLETPLIRAARERNARTVDGL 254 Query: 236 EMLVHQGAKAFEIWTGIEPD---VGVMREAALRALR 268 MLV Q +A IW GI+P R+AAL AL+ Sbjct: 255 CMLVWQALEADRIWLGIDPSEKLYQAARKAALEALQ 290 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 301 Length adjustment: 26 Effective length of query: 243 Effective length of database: 275 Effective search space: 66825 Effective search space used: 66825 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_083818495.1 PYRFU_RS03905 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.5292.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-67 211.7 0.0 7e-67 211.4 0.0 1.0 1 lcl|NCBI__GCF_000223395.1:WP_083818495.1 PYRFU_RS03905 shikimate dehydrog Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000223395.1:WP_083818495.1 PYRFU_RS03905 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 211.4 0.0 7e-67 7e-67 2 264 .. 18 280 .. 17 289 .. 0.93 Alignments for each domain: == domain 1 score: 211.4 bits; conditional E-value: 7e-67 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlel 70 l+g+iG+p+++S+sp+ih+ + ++ g+e +Yl +ve e++ +++g+++l ++G+nvT+P+Ke+v + lcl|NCBI__GCF_000223395.1:WP_083818495.1 18 LYGLIGHPVAQSLSPVIHESVYRKVGVEAVYLLWDVEGREVHFVVEGLRNL-ANGFNVTIPHKERVRAH 85 79**********************************************999.69*************** PP TIGR00507 71 lDeieesakligavNTlkledgklvgynTDgiGlvssLeklsklksekrvliiGAGGaakavaleLlka 139 +D + ++ +gavNT+k+e+ kl nTD++G+ L+ l ++ ++l++GAGGaaka++l+ ++ lcl|NCBI__GCF_000223395.1:WP_083818495.1 86 CDSESSEVSILGAVNTVKVEGAKLHCFNTDVYGVERCLRGLA--SDGFTMLVLGAGGAAKAAVLAAQHL 152 ****************************************54..4579****************99999 PP TIGR00507 140 .dkeviiaNRtvekaeelaerlqe...lgeilalsleevelkkvdliinatsaglsgeideaevkaell 204 ++vii NRt ++a +la ++ ++a++ + ++ d++ nat++g++g ++v+++ + lcl|NCBI__GCF_000223395.1:WP_083818495.1 153 gASTVIISNRTRSRAVQLAGIAEAlglRARVVAWPPPREAIEEADVLFNATPLGMEGVGGAPPVDTDAI 221 6799**************999999444557899**9*********************999********* PP TIGR00507 205 kegklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfea 264 + +++v+D +y+pletpl++ a++++++++dGl Mlv Qa+ + ++w g+ p + ++a lcl|NCBI__GCF_000223395.1:WP_083818495.1 222 SPKHVVFDAIYKPLETPLIRAARERNARTVDGLCMLVWQALEADRIWLGIDPSEK-LYQA 280 *************************************************998643.3333 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (301 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.70 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory