Align Ornithine aminotransferase; OAT; Ornithine--oxo-acid aminotransferase; EC 2.6.1.13 (characterized)
to candidate WP_084019650.1 K420_RS19775 ornithine--oxo-acid transaminase
Query= SwissProt::P38021 (401 letters) >NCBI__GCF_000519045.1:WP_084019650.1 Length = 697 Score = 440 bits (1132), Expect = e-128 Identities = 214/389 (55%), Positives = 281/389 (72%), Gaps = 5/389 (1%) Query: 17 YGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKIT 76 +GA NY PLP+V+S G WV D EG Y+DM+SAYSA + GH HP+++ AL QA ++ Sbjct: 300 FGARNYAPLPVVLSAGSGCWVSDTEGRRYLDMMSAYSANSFGHAHPRLLAALNAQAGRLA 359 Query: 77 LTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAE 136 LTSRA+ ND+L + A L+G E +LP+NTG EAVE+A+KAAR+WAY+VKGV +AE Sbjct: 360 LTSRAYSNDRLPLLLRRLALLSGYERVLPVNTGLEAVETALKAARKWAYQVKGVPPGKAE 419 Query: 137 IIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAFLFE 196 IIAC GNFHGR++ V LSSE +Y+ GFGP PG+K +P+ DV AL AITP+TAAFL E Sbjct: 420 IIACQGNFHGRSIAIVGLSSEAQYRDGFGPFPPGLKTVPFADVAALAAAITPHTAAFLVE 479 Query: 197 PIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYIL 256 PIQGE G+++PP G+L AA+C+ VL I DE+QTGLGRTGK FA + + PD IL Sbjct: 480 PIQGEGGVIMPPPGYLSACAALCRRHGVLLIVDEVQTGLGRTGKLFAYQHEPLRPDGIIL 539 Query: 257 GKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLADRSL 316 GKALGGG+ P+S AD ++ VF PG HGSTFGGNPLA AV++++L++LEDE L + + Sbjct: 540 GKALGGGLLPVSAFLADDALMRVFTPGDHGSTFGGNPLAAAVALSALDLLEDEGLVEHAA 599 Query: 317 ELGEYFKSELESI--DSPVIKEVRGRGLFIGVELTEA---ARPYCERLKEEGLLCKETHD 371 LGE+ + L + +PV++ VRG+GLF G+EL AR ERL + G+L K+TH Sbjct: 600 RLGEHLLARLNELAATTPVVRAVRGKGLFAGIELEPTLADARDMAERLLQHGILTKDTHT 659 Query: 372 TVIRFAPPLIISKEDLDWAIEKIKHVLRN 400 TV+R APPLII + LDWA+++I VLRN Sbjct: 660 TVLRLAPPLIIDRPTLDWALDEITVVLRN 688 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 758 Number of extensions: 26 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 697 Length adjustment: 35 Effective length of query: 366 Effective length of database: 662 Effective search space: 242292 Effective search space used: 242292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate WP_084019650.1 K420_RS19775 (ornithine--oxo-acid transaminase)
to HMM TIGR01885 (rocD: ornithine--oxo-acid transaminase (EC 2.6.1.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01885.hmm # target sequence database: /tmp/gapView.15776.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01885 [M=402] Accession: TIGR01885 Description: Orn_aminotrans: ornithine--oxo-acid transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-148 480.9 0.0 1.7e-148 480.5 0.0 1.1 1 lcl|NCBI__GCF_000519045.1:WP_084019650.1 K420_RS19775 ornithine--oxo-acid Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000519045.1:WP_084019650.1 K420_RS19775 ornithine--oxo-acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 480.5 0.0 1.7e-148 1.7e-148 4 400 .. 293 685 .. 290 687 .. 0.98 Alignments for each domain: == domain 1 score: 480.5 bits; conditional E-value: 1.7e-148 TIGR01885 4 vieleekygahnyhplpvvlskaeGakvwdvegkryldflsaysavnqGhchpkivkalveqaqkltls 72 + ++e+ +ga+ny plpvvls ++G v d+eg+ryld++saysa + Gh+hp++++al qa +l+l+ lcl|NCBI__GCF_000519045.1:WP_084019650.1 293 LQRWENGFGARNYAPLPVVLSAGSGCWVSDTEGRRYLDMMSAYSANSFGHAHPRLLAALNAQAGRLALT 361 56799**************************************************************** PP TIGR01885 73 srafyndvfgefaeyvtklfGydkvlpmntGaeavetaiklarkWgykkkkipedkalilsaegnfhGr 141 sra+ nd ++ + + ++ l Gy++vlp+ntG eaveta+k arkW+y++k++p ka i++++gnfhGr lcl|NCBI__GCF_000519045.1:WP_084019650.1 362 SRAYSNDRLPLLLRRLALLSGYERVLPVNTGLEAVETALKAARKWAYQVKGVPPGKAEIIACQGNFHGR 430 ********************************************************************* PP TIGR01885 142 tlavislstdpesrenfGpyvpnvkkieynnlealeealeeagekvaaflvePiqGeaGvvvpddgylk 210 ++a++ ls++ + r++fGp+ p++k++++ +++al a++ + aaflvePiqGe Gv++p gyl lcl|NCBI__GCF_000519045.1:WP_084019650.1 431 SIAIVGLSSEAQYRDGFGPFPPGLKTVPFADVAALAAAITP---HTAAFLVEPIQGEGGVIMPPPGYLS 496 ************************************99987...89*********************** PP TIGR01885 211 kvrelckkynvlliadeiqtGiartGkllaveheevkPdivllGkalsgGvyPvsavladkevmltikp 279 + +lc+++ vlli+de+qtG++rtGkl+a++he ++Pd ++lGkal+gG++Pvsa lad+++m +++p lcl|NCBI__GCF_000519045.1:WP_084019650.1 497 ACAALCRRHGVLLIVDEVQTGLGRTGKLFAYQHEPLRPDGIILGKALGGGLLPVSAFLADDALMRVFTP 565 ********************************************************************* PP TIGR01885 280 gehGstygGnPlasavavaalevlkeeklaeraeklGeelreelkkl..kkeivkevrGkGllnaivid 346 g+hGst+gGnPla+ava+ al++l++e l+e+a++lGe+l ++l++l ++++v+ vrGkGl+++i ++ lcl|NCBI__GCF_000519045.1:WP_084019650.1 566 GDHGSTFGGNPLAAAVALSALDLLEDEGLVEHAARLGEHLLARLNELaaTTPVVRAVRGKGLFAGIELE 634 **********************************************976679***************** PP TIGR01885 347 eskangreawdlclklkekGllakptheeiirlaPPlviteeelkeaveiikkv 400 ++ ++a d+ +l ++G+l+k+th++++rlaPPl+i + l++a++ i+ v lcl|NCBI__GCF_000519045.1:WP_084019650.1 635 PTL---ADARDMAERLLQHGILTKDTHTTVLRLAPPLIIDRPTLDWALDEITVV 685 **9...78999************************************9988766 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (402 nodes) Target sequences: 1 (697 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 18.83 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory