Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_084055874.1 B9A12_RS02075 MazG family protein
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_900176285.1:WP_084055874.1 Length = 251 Score = 144 bits (362), Expect = 2e-39 Identities = 82/212 (38%), Positives = 118/212 (55%), Gaps = 10/212 (4%) Query: 10 RLTDVIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFLL 69 R+ ++IDRL GCPWD++QTP S+ YLVEE E AIR+ +E EE+GD++F++ Sbjct: 30 RIWEIIDRLRGEGGCPWDRKQTPHSVQTYLVEEAHEAAAAIRADRKEEAAEELGDLLFMV 89 Query: 70 AFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEKADA 129 FL LY +K AF+L+D KMIRRHPHVF D + NWE IK AEK Sbjct: 90 LFLVHLYEEKRAFSLEDVCRAICEKMIRRHPHVFGDVQVHSAKDVRSNWEKIKEAEK--- 146 Query: 130 EGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLAGD- 188 G+ +G+ +P +LP L++AYRI ++ G ++ VE + D+ +GD Sbjct: 147 RGKRRGL--GIPKTLPALVRAYRIRARQEDAG---AASSSLKEAVEMFQASVRDLDSGDL 201 Query: 189 -DKAAQENELGDLIFSLVELGRRKGIKANTAL 219 D + LG L++ V L R G + +L Sbjct: 202 SDPVQAQKRLGHLLYRAVCLARALGRRPEDSL 233 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 251 Length adjustment: 24 Effective length of query: 243 Effective length of database: 227 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory