Align argininosuccinate lyase (EC 4.3.2.1) (characterized)
to candidate WP_084056570.1 B9A12_RS04105 argininosuccinate lyase
Query= BRENDA::Q8DVX5 (460 letters) >NCBI__GCF_900176285.1:WP_084056570.1 Length = 472 Score = 456 bits (1174), Expect = e-133 Identities = 228/455 (50%), Positives = 313/455 (68%), Gaps = 1/455 (0%) Query: 5 NHKLWGGRFEAGLAQWVEEFGASISFDQKLAEFDLKGSIAHVTMLGEKGIISQEDAATIK 64 + KLW GRF+ + VEE+ ASI FD +L +D++GSIAH ML + GIIS ++A+ I Sbjct: 2 SEKLWQGRFDQPTDKMVEEYTASIHFDSRLYRYDIEGSIAHCRMLADCGIISHDEASQIV 61 Query: 65 AGLEDLLEEYKAGQLKFDVSNEDIHMNMESLLTAKIGPVAGKLHTARSRNDQVATDMHLY 124 L ++ E + G+L D S EDIHM +E L KIG V GKLHTARSRNDQ+A D LY Sbjct: 62 QALGEIRRETERGELNLDPSQEDIHMAVEQRLMQKIGEVGGKLHTARSRNDQIALDTRLY 121 Query: 125 LKAKLDEVIEKLANLRTVLVDLADKHVHTIMPGYTHLQHAQPISFGHHLMAYYNMFTRDS 184 ++ L + L ++ T L DLA+K++H I+PG+THLQHAQP+ HHL+AY MF RD Sbjct: 122 MRDVLLQCRRLLLDVITGLTDLAEKNLHVILPGFTHLQHAQPVLLAHHLLAYCEMFLRDE 181 Query: 185 ERFIFNVKHTDLSPLGAAALAGTTFPIDREMTAQLMGFAEPYSNSLDAVSDRDFILEFLS 244 ER T++ PLG+AALAGTTFPID E TA+ +GF NS+DAVSDRD+++EF + Sbjct: 182 ERMAQCFNRTNVMPLGSAALAGTTFPIDMERTARQLGFPRVIRNSMDAVSDRDYLIEFCA 241 Query: 245 NASILMMHMSRMCEEVISWCSHEYQFVTLSDTFSTGSSIMPQKKNPDMAELIRGKSGRVY 304 ++ MMH+SR+ EE++ W S E+ FV +SD F TGSSIMPQKKNPD+ EL+RGK+GR+Y Sbjct: 242 AGALAMMHISRLSEELVLWSSPEFDFVEISDAFCTGSSIMPQKKNPDVPELMRGKTGRIY 301 Query: 305 ANLFGLLTVMKALPLAYNKDLQEDKEGMFDTAETITVALDILAGMLSSMIVNDKHMAEST 364 NL LLT+ K LPL YN+DLQEDKE FDTA+T+ L +L ML ++ +++ M ++ Sbjct: 302 GNLMALLTLTKGLPLTYNRDLQEDKEPAFDTADTLLSTLAVLNKMLPALQFHEEKMVQAA 361 Query: 365 QKDFSNATELADYLASKGMPFRQAHEIVGKLILECSKNGHYLQDVPLERYQTISDLIEED 424 + F+ AT++ADYL KG+PFR+AH +VG+L+ C + G L D L+ + +EED Sbjct: 362 AQSFALATDVADYLVLKGVPFRKAHHVVGQLVSHCIREGKDLSDCTLDELKKFHKALEED 421 Query: 425 VYETLKSHTAVERRHSLGGTGFEQVKWQIAEAKKA 459 ++ L +AV+RR SLGGT E+V+ + EA +A Sbjct: 422 IFSILDIRSAVDRRRSLGGTSTERVR-EALEATRA 455 Lambda K H 0.318 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 559 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 460 Length of database: 472 Length adjustment: 33 Effective length of query: 427 Effective length of database: 439 Effective search space: 187453 Effective search space used: 187453 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate WP_084056570.1 B9A12_RS04105 (argininosuccinate lyase)
to HMM TIGR00838 (argH: argininosuccinate lyase (EC 4.3.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00838.hmm # target sequence database: /tmp/gapView.8151.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00838 [M=455] Accession: TIGR00838 Description: argH: argininosuccinate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-198 643.9 0.1 9.4e-198 643.7 0.1 1.0 1 lcl|NCBI__GCF_900176285.1:WP_084056570.1 B9A12_RS04105 argininosuccinate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176285.1:WP_084056570.1 B9A12_RS04105 argininosuccinate lyase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 643.7 0.1 9.4e-198 9.4e-198 1 454 [. 5 457 .. 5 458 .. 1.00 Alignments for each domain: == domain 1 score: 643.7 bits; conditional E-value: 9.4e-198 TIGR00838 1 lwggRlkkeldkavaefnaslsfDkelaeaDiegsiahtkaLakagilteeeakklieaLeelkeevke 69 lw+gR+++ +dk v+e++as++fD +l+++Diegsiah ++La +gi++++ea+++++aL e+++e+++ lcl|NCBI__GCF_900176285.1:WP_084056570.1 5 LWQGRFDQPTDKMVEEYTASIHFDSRLYRYDIEGSIAHCRMLADCGIISHDEASQIVQALGEIRRETER 73 7******************************************************************** PP TIGR00838 70 gklelevdaeDiHlavErelidkvgedvgkklhtgrsRnDqvatdlrlylrdkvkelaealkdllkalv 138 g+l+l++++eDiH+avE++l++k+g +vg+klht+rsRnDq+a d rly+rd + + ++ l+d+++ l lcl|NCBI__GCF_900176285.1:WP_084056570.1 74 GELNLDPSQEDIHMAVEQRLMQKIG-EVGGKLHTARSRNDQIALDTRLYMRDVLLQCRRLLLDVITGLT 141 *************************.******************************************* PP TIGR00838 139 ekAekevetlmpgytHLqrAqPitlaHhllayaemlerDleRlldalkRvnksPlGsgAlagtsfeidr 207 ++Aek+ ++++pg+tHLq+AqP+ laHhllay em+ rD eR+ + ++R+n+ PlGs+Alagt+f+id lcl|NCBI__GCF_900176285.1:WP_084056570.1 142 DLAEKNLHVILPGFTHLQHAQPVLLAHHLLAYCEMFLRDEERMAQCFNRTNVMPLGSAALAGTTFPIDM 210 ********************************************************************* PP TIGR00838 208 ellaelLgFdavvensldavsdRDfiiEllsaaallmvhlsrlaEelilfsseEfgfvelsdevssgss 276 e++a++LgF +v++ns+davsdRD++iE+ +a al+m+h+srl+Eel+l+ss Ef+fve+sd++++gss lcl|NCBI__GCF_900176285.1:WP_084056570.1 211 ERTARQLGFPRVIRNSMDAVSDRDYLIEFCAAGALAMMHISRLSEELVLWSSPEFDFVEISDAFCTGSS 279 ********************************************************************* PP TIGR00838 277 imPqKKnpDvaEliRgktgrviGnltglltilKalPlaYnkDlqEdkealfdalktveellevvtgllk 345 imPqKKnpDv El+Rgktgr++Gnl++llt+ K+lPl+Yn+DlqEdke+ fd+ +t+ ++l v++ +l lcl|NCBI__GCF_900176285.1:WP_084056570.1 280 IMPQKKNPDVPELMRGKTGRIYGNLMALLTLTKGLPLTYNRDLQEDKEPAFDTADTLLSTLAVLNKMLP 348 ********************************************************************* PP TIGR00838 346 elkvnkerleeaakknfalatdlAdylvrkGvPFReaheivGevvakaiekGkkleeltleelqklsek 414 l++++e++ +aa+++falatd+Adylv kGvPFR+ah++vG++v ++i++Gk+l++ tl+el+k++++ lcl|NCBI__GCF_900176285.1:WP_084056570.1 349 ALQFHEEKMVQAAAQSFALATDVADYLVLKGVPFRKAHHVVGQLVSHCIREGKDLSDCTLDELKKFHKA 417 ********************************************************************* PP TIGR00838 415 leedvlevldleeavekrdakGGtakeevekaieeakael 454 leed++++ld+++av++r++ GGt+ e+v++a+e+++a++ lcl|NCBI__GCF_900176285.1:WP_084056570.1 418 LEEDIFSILDIRSAVDRRRSLGGTSTERVREALEATRADV 457 **********************************999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (472 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.77 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory