Align Homoserine dehydrogenase; HDH; EC 1.1.1.3 (uncharacterized)
to candidate WP_084056978.1 B9A12_RS05960 homoserine dehydrogenase
Query= curated2:Q58997 (336 letters) >NCBI__GCF_900176285.1:WP_084056978.1 Length = 362 Score = 235 bits (599), Expect = 1e-66 Identities = 134/337 (39%), Positives = 200/337 (59%), Gaps = 8/337 (2%) Query: 2 DIIIVGFGAIGKGIAKVLYDKKDYLKKNYE-EFKVVAITDSSGAAIDEDGLDLLKAIEVK 60 +I+++GFG +G+ A+++ +K+D L Y F AI D GA +D G + I Sbjct: 8 NILLLGFGNVGRAFARLVAEKRDELAGRYGVSFGFSAIVDIGGAVVDPAGTLPVLDIHRH 67 Query: 61 EKTGK-IKNYPEKGRE-MSSIDVIKEVDADVVVEVTPSNLETGDPAKTHILESFKNKKHV 118 GK ++ +PE GR + +++ I+ V DV+VE TP+ L G+PA+TH+LE + HV Sbjct: 68 VAAGKALEEFPELGRPGLGALEAIRTVPCDVMVEATPTCLRDGEPARTHVLEGLRAGCHV 127 Query: 119 VTANKGPLALCYKELIEEAKKHGVIFRHEASVGGAMPIINLAKETLAGNEILSIRGILNG 178 ++ANKGP Y ++E A + G+ A+ A+P +++A+ LAG+ ILS+ GILNG Sbjct: 128 ISANKGPFIWAYDTIMEAAMERGLAVGLSAATAAALPTLDVAELCLAGSRILSVEGILNG 187 Query: 179 TTNYILTKMEKEGLDFETALKEAKELGIAETDPTQDIEGLDTAAKIVILANSIMGMNKTI 238 TTNYILT+M + G +E L EA+ LGIAETDP D+EG DTA K++++AN + T Sbjct: 188 TTNYILTRMHQTGCAYEDGLGEAQRLGIAETDPRLDVEGWDTANKLILIANRVFHAGLTP 247 Query: 239 KDVKVKGISRITPEALFLANKRGYTIKLIGQIKDG----YLIVEPMLVPIDSPL-NVKGT 293 +DV V+GI+ +TPE + A G IKLIG+I + V P +P D PL V G+ Sbjct: 248 RDVAVQGITSVTPERIRRARDEGRVIKLIGRIAPSSHPVRVSVGPEALPGDHPLAAVSGS 307 Query: 294 LNVAMFETDLAKEVVVVGRGAGPIETASAILSDLIHI 330 FETD + V G + P+ A+A+L D + I Sbjct: 308 EKAVSFETDSMGRITVSGGHSSPLGAAAALLKDALRI 344 Lambda K H 0.314 0.135 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 272 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 362 Length adjustment: 29 Effective length of query: 307 Effective length of database: 333 Effective search space: 102231 Effective search space used: 102231 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory