Align 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (characterized)
to candidate WP_084057310.1 B9A12_RS07660 3-phosphoshikimate 1-carboxyvinyltransferase
Query= BRENDA::B2IYE4 (426 letters) >NCBI__GCF_900176285.1:WP_084057310.1 Length = 439 Score = 311 bits (798), Expect = 2e-89 Identities = 171/423 (40%), Positives = 255/423 (60%), Gaps = 3/423 (0%) Query: 2 DTIEIPALNRPVDATVEIPGSKSLTNRALLVAALAQGDSILENALFSEDSEYFAKCLEQL 61 + + IP + R V V +PGSKS+T+RA ++AAL+ G+S++ NAL +ED+ A L L Sbjct: 16 EEVAIPTVER-VTGRVPLPGSKSVTHRAFILAALSGGESVVLNALDAEDTRVTASALRDL 74 Query: 62 GIPITLNPHLAQIQLAGRGGEIPAKQADLFVGLSGTTARFISALVALGNGEYRLDGVPRM 121 G + +I+ P+ + VG SGT+ R ++ L A G G + DG R+ Sbjct: 75 GARVEWRGSTVRIRPPHELWRSPSSPIN--VGNSGTSLRLLAGLAAAGKGTFVFDGTARL 132 Query: 122 RERPMGDMLTVLETGGATVNFEGNSGFMPYTVYSQGFAGGNFCLKANQTSQQLSALLMIA 181 RERP+G + LET GA V F G+ P + S G GG C+ A+Q+SQ LS++L+ + Sbjct: 133 RERPVGALTVALETLGAVVRFPLKRGYPPVVIESDGLCGGRVCVDASQSSQYLSSILLAS 192 Query: 182 PYAQQDTIFEVEGTLVSLSYIKMTCRLMADFGVEVIQIGDNQFQIKAGQRYQAQHYTVEP 241 A E + S Y+++T ++MA G++ + G + + A Q + HY VE Sbjct: 193 TKASGPVAVSWEENVSSFPYVEITLQMMAQAGLDFRKAGPTEVVVNAPQVVKPFHYRVEG 252 Query: 242 DASNASYFFAAAAVTGGRVRVKHLTKQSCQGDILWLNVLEQMGCQIKDSDDYTEVTGPKQ 301 D S+ASYF+AAAA+TGG V +++ + QGD +L++L MGC++ +++ V GP+ Sbjct: 253 DCSSASYFWAAAALTGGSVLTYPVSQAALQGDCAFLDILSAMGCRVDWTEEGVCVQGPRT 312 Query: 302 LQGIDIDMNDISDLVQTLAAIAPFASSPITIRNVEHIRYKETDRIKAVVTELRRLGVQVE 361 L+ +D DMN + D+V TLA +A A IRNV H+R KE+DR++AV EL +LGVQVE Sbjct: 313 LRSVDADMNRMPDMVPTLAVLAACAEGASRIRNVAHLRIKESDRLRAVAVELSKLGVQVE 372 Query: 362 EFPDRLKIEPGPITPAEIETYHDHRMAMAFAVTGLKVPGIVIKDPGCTAKTFPDYFTRFF 421 E D L I+ P A IETY DHR+AMAFAV GL+VPG+VI+ K+FP+++ FF Sbjct: 373 EGSDGLVIQGPPRRGATIETYEDHRIAMAFAVLGLRVPGVVIRGAATVRKSFPEFWDTFF 432 Query: 422 QML 424 ++ Sbjct: 433 GLI 435 Lambda K H 0.320 0.136 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 439 Length adjustment: 32 Effective length of query: 394 Effective length of database: 407 Effective search space: 160358 Effective search space used: 160358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_084057310.1 B9A12_RS07660 (3-phosphoshikimate 1-carboxyvinyltransferase)
to HMM TIGR01356 (aroA: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01356.hmm # target sequence database: /tmp/gapView.6427.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01356 [M=415] Accession: TIGR01356 Description: aroA: 3-phosphoshikimate 1-carboxyvinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-132 427.2 0.0 3.7e-132 427.0 0.0 1.0 1 lcl|NCBI__GCF_900176285.1:WP_084057310.1 B9A12_RS07660 3-phosphoshikimate Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176285.1:WP_084057310.1 B9A12_RS07660 3-phosphoshikimate 1-carboxyvinyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.0 0.0 3.7e-132 3.7e-132 1 411 [. 28 433 .. 28 437 .. 0.97 Alignments for each domain: == domain 1 score: 427.0 bits; conditional E-value: 3.7e-132 TIGR01356 1 geikipgsKSishRalllaaLaegetvvtnlLkseDtlatlealrklGakveeekeelviegvgg.lke 68 g++ +pgsKS++hRa++laaL+ ge+vv n L++eDt++t +alr+lGa+ve + ++ i++ + + lcl|NCBI__GCF_900176285.1:WP_084057310.1 28 GRVPLPGSKSVTHRAFILAALSGGESVVLNALDAEDTRVTASALRDLGARVEWRGSTVRIRPPHElWRS 96 68899***********************************************8899******9987899 PP TIGR01356 69 peaeldlgnsGttaRlltgvlalasgevvltgdeslkkRPierlveaLrelgaeieskeeegslPlais 137 p++ +++gnsGt++Rll g++a+ +g++v++g +l++RP++ l+ aL+ lga ++ ++g++P++i+ lcl|NCBI__GCF_900176285.1:WP_084057310.1 97 PSSPINVGNSGTSLRLLAGLAAAGKGTFVFDGTARLRERPVGALTVALETLGAVVRFPLKRGYPPVVIE 165 99******************************************************************* PP TIGR01356 138 gp.lkggivelsgsaSsQyksalllaaplalqavtleivgeklisrpyieitLkllksfgveveeeder 205 ++ l gg v +++s SsQy+s++lla +a+ +v ++ ++ +++s py+eitL++++++g ++++ + lcl|NCBI__GCF_900176285.1:WP_084057310.1 166 SDgLCGGRVCVDASQSSQYLSSILLASTKASGPVAVSWEE-NVSSFPYVEITLQMMAQAGLDFRKAGPT 233 *98888*********************9999899888887.************************999* PP TIGR01356 206 kivvkggqkykqkevevegDaSsAafflaaaaitgeevtvenlgenstqgdkaiiivLeemGadvevee 274 ++vv+ q k+ +++vegD SsA++f aaaa+tg+ v + ++ +qgd a++++L++mG++v+++e lcl|NCBI__GCF_900176285.1:WP_084057310.1 234 EVVVNAPQVVKPFHYRVEGDCSSASYFWAAAALTGGSVLTYPVSQAALQGDCAFLDILSAMGCRVDWTE 302 *******999999******************************************************** PP TIGR01356 275 qrdvevegasklkgvkvdidvdsliDelptlavlaafAegetriknieelRvkEsdRiaaiaeeLeklG 343 + v v+g++ l+ v+ +d+++++D +ptlavlaa+Aeg +ri+n+++lR+kEsdR++a+a eL+klG lcl|NCBI__GCF_900176285.1:WP_084057310.1 303 E-GVCVQGPRTLRSVD--ADMNRMPDMVPTLAVLAACAEGASRIRNVAHLRIKESDRLRAVAVELSKLG 368 *.7**********999..*************************************************** PP TIGR01356 344 veveeledgllieGkkkelkgavvdtydDHRiamalavlglaaegeveiedaecvaksfPeFfevleq 411 v+vee++dgl+i+G +ga+++ty+DHRiama+avlgl++ +v i +a++v+ksfPeF++ lcl|NCBI__GCF_900176285.1:WP_084057310.1 369 VQVEEGSDGLVIQGPP--RRGATIETYEDHRIAMAFAVLGLRVP-GVVIRGAATVRKSFPEFWDTFFG 433 ***************5..899**********************9.******************98765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (415 nodes) Target sequences: 1 (439 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory