GapMind for Amino acid biosynthesis

 

Alignments for a candidate for leuD in Desulfacinum hydrothermale DSM 13146

Align 3-isopropylmalate dehydratase small subunit 2; EC 4.2.1.33; Alpha-IPM isomerase 2; IPMI 2; Isopropylmalate isomerase 2 (uncharacterized)
to candidate WP_084057352.1 B9A12_RS07905 aconitate hydratase AcnA

Query= curated2:Q9RTI0
         (208 letters)



>NCBI__GCF_900176285.1:WP_084057352.1
          Length = 917

 Score = 43.9 bits (102), Expect = 9e-09
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 14/75 (18%)

Query: 52  IIVAGADFGCGSSREHAVWALRG---AGVSAVIAPNFARIYYRNSINNGFLALECEGITE 108
           I++ GA++G GSSR+   WA +G    GV AV+A +F RI+  N +  G L L       
Sbjct: 789 IVLGGAEYGTGSSRD---WAAKGPNLLGVRAVLARSFERIHRSNLVGMGVLPL------- 838

Query: 109 LFQDGEEAE-LDLKG 122
            FQ+GE  E L L G
Sbjct: 839 AFQEGESWESLGLNG 853


Lambda     K      H
   0.315    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 476
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 208
Length of database: 917
Length adjustment: 32
Effective length of query: 176
Effective length of database: 885
Effective search space:   155760
Effective search space used:   155760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory