Align Histidinol-phosphate aminotransferase; EC 2.6.1.9; Imidazole acetol-phosphate transaminase (uncharacterized)
to candidate WP_084057874.1 B9A12_RS10615 histidinol-phosphate transaminase
Query= curated2:Q6AQK2 (379 letters) >NCBI__GCF_900176285.1:WP_084057874.1 Length = 396 Score = 347 bits (889), Expect = e-100 Identities = 182/364 (50%), Positives = 249/364 (68%), Gaps = 4/364 (1%) Query: 14 IPENIENIKPYPPGKPLDELEREYGITDSIKLASNENPWGASPKAIKAIGESLGDMQRYP 73 +P +I I+PYPPGKP++ELERE GI SIKLASNENP G SPKA++AI E L + RYP Sbjct: 29 VPPHIAAIEPYPPGKPIEELERELGIVGSIKLASNENPLGPSPKALQAIEEKLETLHRYP 88 Query: 74 DGSAYYLTEAIAKYAGVGMSEIILGNGSNEVIEFLVKAFVQDDSEVITSHPSFLMYQKFV 133 DGS YYL IA+ GV M ++LGNGSNE+IE +++ FVQ EVI +PSFL+YQ V Sbjct: 89 DGSGYYLRNRIAEKFGVPMDGVVLGNGSNEIIELVIRTFVQPGLEVIVPNPSFLVYQLSV 148 Query: 134 QVRGGVNRVIPLKDMHHDLQTILDTVNEKTRLIFIDNPNNPTGTYLEPELLIDFINSLPE 193 Q GG +PL+D+ DL+ IL + EKTRLIFI+NPNNPTGT L + F+ +P+ Sbjct: 149 QCVGGSLVFVPLRDLMIDLEGILKAITEKTRLIFINNPNNPTGTVLPRKNFEAFLEQVPK 208 Query: 194 HVILVLDEAYVDFMDLD-KWLDVPSLIKNQAGRCGIVSLRTFSKAYGLSGLRVGFGLMAE 252 V++V+DEAY++F D + +L L + +V RTFSKAYGL+GLRVG+G+M Sbjct: 209 DVLVVVDEAYIEFADPNGTFLGFDYLDRRGP---WVVVTRTFSKAYGLAGLRVGYGVMDP 265 Query: 253 EIVTCLHKVRQPFNVNSLAQVGALAALGDVDFYEQTLLKNRQGMKWLMKEIKGLGCEPFA 312 + LH+VRQPFNV++ AQ ALAAL D F E++ R+ + WL ++++ +G + Sbjct: 266 AVADYLHRVRQPFNVSTPAQAAALAALDDEAFLEKSRTLVREQLPWLYQQVQEMGLDFQP 325 Query: 313 SQTNFFLIDVQGNADKLYTEMLYKGVIIRSMSAYGYPHYIRVTVGTTVENKRFLKALSDC 372 +Q NFFLI + A +Y ML +GVI+R+M++YG P +IR+ VGT EN+RF++ L Sbjct: 326 TQANFFLIRMPVEAKVVYQAMLQEGVIVRAMNSYGLPRHIRINVGTPQENERFIRTLRKV 385 Query: 373 LKEL 376 LK+L Sbjct: 386 LKDL 389 Lambda K H 0.320 0.139 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 396 Length adjustment: 30 Effective length of query: 349 Effective length of database: 366 Effective search space: 127734 Effective search space used: 127734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_084057874.1 B9A12_RS10615 (histidinol-phosphate transaminase)
to HMM TIGR01141 (hisC: histidinol-phosphate transaminase (EC 2.6.1.9))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01141.hmm # target sequence database: /tmp/gapView.32702.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01141 [M=349] Accession: TIGR01141 Description: hisC: histidinol-phosphate transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-115 370.7 0.0 3.7e-115 370.5 0.0 1.0 1 lcl|NCBI__GCF_900176285.1:WP_084057874.1 B9A12_RS10615 histidinol-phospha Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176285.1:WP_084057874.1 B9A12_RS10615 histidinol-phosphate transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 370.5 0.0 3.7e-115 3.7e-115 2 349 .] 31 385 .. 30 385 .. 0.97 Alignments for each domain: == domain 1 score: 370.5 bits; conditional E-value: 3.7e-115 TIGR01141 2 ekikklepYqpg......arelgekevvkLnsnEnPfgpsekvkealkeelkklhrYpdpqalelkeal 64 ++i ++epY pg +relg+ + +kL+snEnP+gps+k+++a++e+l++lhrYpd +++ l++++ lcl|NCBI__GCF_900176285.1:WP_084057874.1 31 PHIAAIEPYPPGkpieelERELGIVGSIKLASNENPLGPSPKALQAIEEKLETLHRYPDGSGYYLRNRI 99 57999**************************************************************** PP TIGR01141 65 akylgveeenillgnGsdelielliraflepgdavlvleptysmYevsakiagaevkevplkedgqedl 133 a+++gv ++ ++lgnGs+e+iel+ir+f++pg +v+v++p++ +Y++s++ g +++ vpl++ dl lcl|NCBI__GCF_900176285.1:WP_084057874.1 100 AEKFGVPMDGVVLGNGSNEIIELVIRTFVQPGLEVIVPNPSFLVYQLSVQCVGGSLVFVPLRDL-MIDL 167 **************************************************************99.699* PP TIGR01141 134 eavleaakekvklvflasPnnPtGnllkreeiekvleev.edalVVvDeAYieFsee...asvlellae 198 e +l+a++ek++l+f+ +PnnPtG++l r+++e++le+v +d+lVVvDeAYieF++ +++l + lcl|NCBI__GCF_900176285.1:WP_084057874.1 168 EGILKAITEKTRLIFINNPNNPTGTVLPRKNFEAFLEQVpKDVLVVVDEAYIEFADPngtFLGFDYLDR 236 ***************************************88**************98654445677776 PP TIGR01141 199 y.pnlvvlrTlSKafgLAglRvGyaianaeiiealekvrapynvsslaleaavaalrdsdkiektveev 266 + p +vv+rT+SKa+gLAglRvGy++++++++++l++vr+p+nvs++a++aa+aal+d++++ek+ v lcl|NCBI__GCF_900176285.1:WP_084057874.1 237 RgPWVVVTRTFSKAYGLAGLRVGYGVMDPAVADYLHRVRQPFNVSTPAQAAALAALDDEAFLEKSRTLV 305 5379***************************************************************** PP TIGR01141 267 kkererlleelkkleglevyeSkaNFvlikvkedaeelleallekgiivRdlksaeglleeclRitvGt 335 +++ +l+++++++ gl+ + +aNF li+++ +a+ +++a+l++g+ivR ++s+ gl + ++Ri vGt lcl|NCBI__GCF_900176285.1:WP_084057874.1 306 REQLPWLYQQVQEM-GLDFQPTQANFFLIRMPVEAKVVYQAMLQEGVIVRAMNSY-GL-PRHIRINVGT 371 **************.8***************************************.85.********** PP TIGR01141 336 reenerllealkei 349 ++ener+++ l+++ lcl|NCBI__GCF_900176285.1:WP_084057874.1 372 PQENERFIRTLRKV 385 **********9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (396 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.92 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory