Align Tryptophan synthase alpha chain; EC 4.2.1.20 (characterized, see rationale)
to candidate WP_084058686.1 B9A12_RS13760 tryptophan synthase subunit alpha
Query= uniprot:H0BV16 (269 letters) >NCBI__GCF_900176285.1:WP_084058686.1 Length = 284 Score = 201 bits (511), Expect = 1e-56 Identities = 113/254 (44%), Positives = 152/254 (59%), Gaps = 5/254 (1%) Query: 1 MSRIASTFSALQAQGRKALIPYVTAGFPFADITPALMHGMVEAGADVIELGVPFSDPMAD 60 MSR+ F L+ +G AL+ +VTAG P + + AL+ M EAG DV+ELGVPFSDP AD Sbjct: 1 MSRLGQVFKELRQRGEGALVGFVTAGDPNPETSLALIRSMCEAGLDVLELGVPFSDPTAD 60 Query: 61 GPVIQKAGEKALSLGIGMVQVLDHVREFRKRNNTTPVVLMGYANPVERYDQKHGEGAFVR 120 GPVIQ++ +AL G+ + +V RE R R + PVV+ Y NP+ G AF Sbjct: 61 GPVIQRSSARALGQGMTLEKVFGLCREIR-RFSRVPVVIFSYYNPILAV----GPDAFYE 115 Query: 121 DSAAAGVDGVLIVDYPPEECEAFAASLRAHGMDLIFLLAPTSTDERMAEVARVASGYVYY 180 + AG DGVL+VD PPEE + + +DLI L+APT+ RM + R ASG+VY Sbjct: 116 KAVDAGADGVLVVDLPPEESPEMLDAWKGRDLDLIRLVAPTTPTPRMEAITREASGFVYL 175 Query: 181 VSLKGVTGSGALDTAAVEQMLPRIRQHVTIPVGVGFGIRDAATAQAIGKVADAVVIGSRI 240 VS+ GVTGS LD + VE R++Q ++PV VGFGI +A+ VAD V+GS Sbjct: 176 VSMTGVTGSAGLDLSEVEATAVRLKQVTSLPVCVGFGISKPEHVEAVCGVADGAVVGSAF 235 Query: 241 IQLIEDQEHAKVVP 254 +LIE+ K +P Sbjct: 236 ERLIEENLETKTLP 249 Lambda K H 0.321 0.137 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 224 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 284 Length adjustment: 25 Effective length of query: 244 Effective length of database: 259 Effective search space: 63196 Effective search space used: 63196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_084058686.1 B9A12_RS13760 (tryptophan synthase subunit alpha)
to HMM TIGR00262 (trpA: tryptophan synthase, alpha subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00262.hmm # target sequence database: /tmp/gapView.27939.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00262 [M=256] Accession: TIGR00262 Description: trpA: tryptophan synthase, alpha subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-88 281.6 0.0 2.4e-88 281.3 0.0 1.0 1 lcl|NCBI__GCF_900176285.1:WP_084058686.1 B9A12_RS13760 tryptophan synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176285.1:WP_084058686.1 B9A12_RS13760 tryptophan synthase subunit alpha # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 281.3 0.0 2.4e-88 2.4e-88 1 245 [. 8 248 .. 8 260 .. 0.96 Alignments for each domain: == domain 1 score: 281.3 bits; conditional E-value: 2.4e-88 TIGR00262 1 fetlkkkeekafvpFvtagdPdleksleiiktlvkaGadalElGvpfsDPlaDGptiqaaelRAlkagv 69 f++l++++e a+v FvtagdP+ e+sl +i+++++aG d+lElGvpfsDP aDGp+iq+++ RAl +g+ lcl|NCBI__GCF_900176285.1:WP_084058686.1 8 FKELRQRGEGALVGFVTAGDPNPETSLALIRSMCEAGLDVLELGVPFSDPTADGPVIQRSSARALGQGM 76 899****************************************************************** PP TIGR00262 70 kvekalellkkvrekasniPivlltyynlifkkgveeFyakakeagvdgvlvaDlPleeaddlleaakk 138 ++ek++ l +++r+ s +P+v+++yyn+i++ g ++Fy+ka +ag dgvlv+DlP ee+ ++l+a k lcl|NCBI__GCF_900176285.1:WP_084058686.1 77 TLEKVFGLCREIRRF-SRVPVVIFSYYNPILAVGPDAFYEKAVDAGADGVLVVDLPPEESPEMLDAWKG 144 ***************.9**************************************************** PP TIGR00262 139 hgvkqiflvaPtaeeerlkkiaekseGfvYlvsvaGvtgarerveeevkelikkvkalskkPvlvGFGi 207 ++++ i lvaPt++ r+++i+++++GfvYlvs++Gvtg +ev++ ++k++++ Pv+vGFGi lcl|NCBI__GCF_900176285.1:WP_084058686.1 145 RDLDLIRLVAPTTPTPRMEAITREASGFVYLVSMTGVTGSAGLDLSEVEATAVRLKQVTSLPVCVGFGI 213 ****************************************9999999********************** PP TIGR00262 208 skkeqvkelkelgadgvivGsAlvkiieeklddeekal 245 sk+e+v+++ + adg++vGsA+ ++iee+l+++ +l lcl|NCBI__GCF_900176285.1:WP_084058686.1 214 SKPEHVEAVCGV-ADGAVVGSAFERLIEENLETK--TL 248 ***********9.99***************9854..33 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (256 nodes) Target sequences: 1 (284 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.19 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory