Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate WP_084058934.1 B9A12_RS15100 hypothetical protein
Query= BRENDA::E6TUA8 (302 letters) >NCBI__GCF_900176285.1:WP_084058934.1 Length = 336 Score = 125 bits (314), Expect = 1e-33 Identities = 87/275 (31%), Positives = 128/275 (46%), Gaps = 9/275 (3%) Query: 1 MSSQWIFSNGKFVTKQEAVISVYDHGFLYGDGVFEGIRVYDGNIFKLTEHLKRLYESAQS 60 M S W+ G + VI V DH GDG+FE + DG ++ L HL RL S Sbjct: 31 MYSSWL--GGILTDPRLMVIPVDDHLVHRGDGIFEAFKCVDGFLYLLDRHLDRLERSCAI 88 Query: 61 IMLEIPYSKEDFQQIIVDTVRKNQLESGYIRVVVSRGPGNLGLDPSRCSAPHVIVIAEEL 120 L P + +++I TVR + +R+ +SRGPG DP C A + ++ L Sbjct: 89 AQLTWPVDRPRLEELIKQTVRASGKRECLVRLFLSRGPGGFTTDPYECPASQLYIVITRL 148 Query: 121 ALFPKELYELGLTVASVASRRNRPDVLSPQIKSLNYLNNILVKLEANQAGAHEALMLNDQ 180 P+E G+T+ S + S +KS NYL N+L+ EA AG + ++++ Sbjct: 149 KHAPEEKLTQGVTLKSSHIPIKKSYFAS--VKSCNYLPNVLMTKEARDAGVDFTVSIDEK 206 Query: 181 GYVTEGSADNIFIVKNNTIITPPVYLGALEGITRNAIIDLA---KECG--YEMKETPFTR 235 G + EG+ +N+ IV + P + L G T +++LA E G + E Sbjct: 207 GLLGEGATENVGIVTRDNRFLVPRFDRILRGTTVTRMLELAGNLVEQGELAQAAEADIRP 266 Query: 236 HDVYVADEVFLTGTAAEVIAVVEVDKRMISDGKPG 270 D Y A EV GT V+ VV+ D I DG PG Sbjct: 267 EDAYQAAEVMTFGTTFNVLPVVQYDGNPIGDGVPG 301 Lambda K H 0.318 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 213 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 302 Length of database: 336 Length adjustment: 27 Effective length of query: 275 Effective length of database: 309 Effective search space: 84975 Effective search space used: 84975 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory