Align ATP phosphoribosyltransferase (EC 2.4.2.17) (characterized)
to candidate WP_084075750.1 BUB04_RS00270 ATP phosphoribosyltransferase
Query= reanno::Miya:8501229 (293 letters) >NCBI__GCF_900129305.1:WP_084075750.1 Length = 290 Score = 375 bits (964), Expect = e-109 Identities = 187/287 (65%), Positives = 225/287 (78%) Query: 7 LKIGIPKGSLEEATVNLFARSGWKIRKHHRNYFPEINDPELTARLCRVQEIPRYLEDGVL 66 L +GIPKGSL+EAT+ LF +SGWKI +RNYFPEINDPE+ +CR QE+ RY+E+G Sbjct: 4 LILGIPKGSLQEATIALFLKSGWKISLTNRNYFPEINDPEIQCSICRAQEMSRYVENGTF 63 Query: 67 DVGLTGKDWLLETGADVVTVSDLVYSKVSNRPARWVLAVAGDSPYVRPEDLAGCTIATEL 126 DVGLTGKDW++E +DV V+DL+YSKVS RPARWVLAV DSP +DL G IATEL Sbjct: 64 DVGLTGKDWIMENDSDVHVVADLIYSKVSQRPARWVLAVPYDSPVQDLQDLQGKKIATEL 123 Query: 127 LGVTRRYFEDAGIPVKVQYSWGATEAKVVEGLADAIVEVTETGTTIKAHGLRIIAEVLLT 186 + TRRYF AG+ VKV++SWGATEAKV+ GL DAIVEVTETG T++A+GLRI+ E++ + Sbjct: 124 VNFTRRYFAQAGVDVKVEFSWGATEAKVIAGLCDAIVEVTETGATMRANGLRIVKELMQS 183 Query: 187 NTVLIAGKAAWADPWKRAKIEQIDLLLQGALRADSLVGLKMNVPAHNLDAVLDQLPSLNS 246 NT LIA K AWADPWKR KIEQI LLLQ ALRA+ LVGLKMNVP L+ V++ LPSL S Sbjct: 184 NTQLIANKQAWADPWKREKIEQIALLLQAALRAEDLVGLKMNVPKGKLNDVIEILPSLTS 243 Query: 247 PTVAGLRDSTWYAVEIVVENDLVRDLIPRLRAAGAEGIIEYSLNKVI 293 PT A L S W +VE+VV +VR+L+P+L GAEGIIEYSLNKVI Sbjct: 244 PTTAHLYQSDWVSVEVVVSKHMVRELVPQLIKRGAEGIIEYSLNKVI 290 Lambda K H 0.318 0.136 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 340 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 290 Length adjustment: 26 Effective length of query: 267 Effective length of database: 264 Effective search space: 70488 Effective search space used: 70488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_084075750.1 BUB04_RS00270 (ATP phosphoribosyltransferase)
to HMM TIGR00070 (hisG: ATP phosphoribosyltransferase (EC 2.4.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00070.hmm # target sequence database: /tmp/gapView.31648.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00070 [M=183] Accession: TIGR00070 Description: hisG: ATP phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-57 180.8 0.0 2.6e-57 179.8 0.0 1.5 2 lcl|NCBI__GCF_900129305.1:WP_084075750.1 BUB04_RS00270 ATP phosphoribosyl Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900129305.1:WP_084075750.1 BUB04_RS00270 ATP phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 179.8 0.0 2.6e-57 2.6e-57 2 183 .] 5 189 .. 4 189 .. 0.97 2 ? -2.3 0.0 0.18 0.18 1 12 [. 222 233 .. 222 262 .. 0.79 Alignments for each domain: == domain 1 score: 179.8 bits; conditional E-value: 2.6e-57 TIGR00070 2 riAlpKGrleeetlkllekaglklskkeerkliasaedeevevlllrakdiptyvekgaadlGitGkDl 70 +++pKG+l+e t++l+ k+g+k+s ++ r+++ +++d+e+++ ++ra+++ +yve+g +d+G+tGkD+ lcl|NCBI__GCF_900129305.1:WP_084075750.1 5 ILGIPKGSLQEATIALFLKSGWKISLTN-RNYFPEINDPEIQCSICRAQEMSRYVENGTFDVGLTGKDW 72 589*************************.**************************************** PP TIGR00070 71 leEseadvvelldlgfgkc.....klvlAvpeesdvesledlkegkriATkypnltreylekkgvkvei 134 ++E+++dv ++dl ++k ++vlAvp +s+v++l+dl+ gk+iAT+ +n tr+y+++ gv+v++ lcl|NCBI__GCF_900129305.1:WP_084075750.1 73 IMENDSDVHVVADLIYSKVsqrpaRWVLAVPYDSPVQDLQDLQ-GKKIATELVNFTRRYFAQAGVDVKV 140 **************8888767777*******************.9************************ PP TIGR00070 135 vkleGavElapllgladaIvDivetGttLrengLkiieeilessarlia 183 ++Ga+E+++++gl daIv ++etG+t+r+ngL+i++e+++s++ lia lcl|NCBI__GCF_900129305.1:WP_084075750.1 141 EFSWGATEAKVIAGLCDAIVEVTETGATMRANGLRIVKELMQSNTQLIA 189 ***********************************************96 PP == domain 2 score: -2.3 bits; conditional E-value: 0.18 TIGR00070 1 lriAlpKGrlee 12 l++ +pKG+l + lcl|NCBI__GCF_900129305.1:WP_084075750.1 222 LKMNVPKGKLND 233 688899999864 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (183 nodes) Target sequences: 1 (290 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 8.31 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory