Align Phosphoserine aminotransferase; EC 2.6.1.52; Phosphohydroxythreonine aminotransferase; PSAT (uncharacterized)
to candidate WP_084236078.1 HTA01S_RS12950 3-phosphoserine/phosphohydroxythreonine transaminase
Query= curated2:C1D8N3 (359 letters) >NCBI__GCF_001592305.1:WP_084236078.1 Length = 370 Score = 261 bits (667), Expect = 2e-74 Identities = 147/356 (41%), Positives = 201/356 (56%), Gaps = 7/356 (1%) Query: 4 YNFSAGPALLPQDVLREAQRELTDWHGSGMSVMEMSHRGREFMSIHARAEADLRELLQIP 63 + FSA LP DV+ E W G G SV+ + F + +A LR LL +P Sbjct: 22 HRFSAAAGPLPPDVVDEVAEACRSWRGGG-SVLSLPFISEAFRELQHETQARLRRLLGLP 80 Query: 64 DNYRVLFLQGGAHSQFSMVPMNLLRGKTTADYVITGHWGKVAIKEARCYGDMRIAATGEA 123 Y+VLF+QGGA +QF++VP+NLL A ++ TGHW + A EA + + T Sbjct: 81 PGYQVLFMQGGASAQFALVPLNLLGLDGAAAHLDTGHWSRRAAAEAARHARV---VTLRH 137 Query: 124 SGFNGIPPQSEWQPNPDAAYLHYVSNETIGGVQFPFIPESGVPLVCDMSSDFLSRPVDVS 183 + P E P AYLH SNET G Q+P +P S PLV DMSSD L+R +D + Sbjct: 138 DALDEPAPPRETSP---VAYLHLTSNETADGWQWPRLPTSPWPLVVDMSSDLLTRAIDCT 194 Query: 184 RFGLIFAGAQKNIGPAGLTLVIVREDLLGQTLPGTPTMFDYKIHADADSMYNTPPTYAIY 243 GL++A AQK +G GLTLVIVR+DLLG+ P P + +Y A ADS NTPP +AI+ Sbjct: 195 GLGLLYASAQKALGVPGLTLVIVRDDLLGRARPSLPGVMNYTALAAADSRLNTPPVFAIF 254 Query: 244 MAGLVFQWLKDNGGVRGIQMRNEEKAGLLYHTIDSSDGFYRCPVDVECRSRMNVPFRLRT 303 +A + W++ GGV + ++ +Y +D+S GFYR V RS ++ F L Sbjct: 255 VAHAMLGWIERQGGVPAMARTAARRSHAVYQALDTSGGFYRPQVGPAWRSSVHPCFGLAE 314 Query: 304 EVLEKRFVDEADMAGLLQLKGHRSVGGVRASIYNAMPFEGVKALVAFMAEFARRHG 359 L RF+++A AGL L+GH VGG+R S+YN P V AL++F+ EF R HG Sbjct: 315 RALTPRFLEQARAAGLFDLQGHPDVGGLRVSLYNGTPEAAVSALLSFLQEFQRTHG 370 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 351 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 370 Length adjustment: 29 Effective length of query: 330 Effective length of database: 341 Effective search space: 112530 Effective search space used: 112530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory