Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (uncharacterized)
to candidate WP_084275301.1 B8779_RS04195 aminodeoxychorismate synthase component I
Query= curated2:Q08653 (461 letters) >NCBI__GCF_900176045.1:WP_084275301.1 Length = 313 Score = 109 bits (272), Expect = 1e-28 Identities = 86/270 (31%), Positives = 144/270 (53%), Gaps = 38/270 (14%) Query: 186 QFYKVVEKAKKYIVEGDIFQVVLS---QAFTFKTTLDPFYIYRALRMINPSPYMFYLKFG 242 +++K ++ I G+ + + L+ + T T L+ FY +A F L F Sbjct: 66 KYHKAFTYVQEEIKNGNTYLLNLTFPTKIATDSTLLEIFYATKA---------KFKLYFQ 116 Query: 243 DTVVLGSSPETMAKVEGDKATVKPIAGTRPRGRTVEEDL-KLERELLNDEKEIAEHVMLV 301 D+ + SPE K+E + + P+ GT ++ +L ++++L++ KE+AEH M+V Sbjct: 117 DSFIC-FSPERFVKIEDNCISTYPMKGT------IDANLPNAKQKILSNIKEMAEHTMVV 169 Query: 302 DLGRNDLGRVCKEGTVRVEKKMVIERY----SHVMHIVSQVSGELKD--DKDAVDVFEAT 355 DL RNDL V K VRV++ +++ ++ + S++ G+L+ K ++F+A Sbjct: 170 DLLRNDLNMVAKN--VRVKRFRYVDKIRAGDKELLQVSSEIEGKLEPHWQKHLGEIFDAL 227 Query: 356 FPAGTVSGAPKVRAMEIIEELEPTPRGPYAGAVGYFSFPDDKGRMNMDSAITIRSFFFKG 415 PAG+++G PK+ IIE+ E RG Y G GYF D K ++DSA+ IR F + Sbjct: 228 LPAGSITGTPKISTCHIIEKAEQYARGFYTGVFGYF---DGK---SLDSAVMIR--FIEK 279 Query: 416 KQGWL--QAGAGIVYDSVPEREYQETLNKL 443 G L ++G GI DS E EY+E L+K+ Sbjct: 280 SPGGLVYKSGGGITIDSDVEAEYKELLDKI 309 Lambda K H 0.319 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 461 Length of database: 313 Length adjustment: 30 Effective length of query: 431 Effective length of database: 283 Effective search space: 121973 Effective search space used: 121973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory