Align Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 (uncharacterized)
to candidate WP_084275302.1 B8779_RS04200 aspartate carbamoyltransferase catalytic subunit
Query= curated2:A2SQ85 (305 letters) >NCBI__GCF_900176045.1:WP_084275302.1 Length = 291 Score = 111 bits (277), Expect = 2e-29 Identities = 91/305 (29%), Positives = 140/305 (45%), Gaps = 20/305 (6%) Query: 1 MKKDFLSITDLSAEEYEDILTLAARLKRQRYAGVPHPLLAGKTLAMIFEKASTRTRMSFD 60 M K ++ DL EE EDI LA + + Y LL K + IF + STRTR SF+ Sbjct: 1 MSKHLITTKDLKKEEIEDIFNLATQFLQPPY----EKLLQDKLIITIFFENSTRTRSSFE 56 Query: 61 VGMYDLGGYALYLNAKDTQLGRGETVADTARVMSRYVHGAIMRTYKHETITE-FAKYASI 119 V +LG + L+ + +GET+ DTA + AI+ +KH A++ S Sbjct: 57 VAAKNLGAQVVNLDVTRSSTKKGETLFDTAANLDAMGPNAIVVRHKHAGAPALLARHVSC 116 Query: 120 PVINALSDKE-HPCQIMADSLTLKEKFGELDGLKIAWIGDGNN--VCNSLIMASVQTGME 176 +IN HP Q + D TLK+ G + G KIA +GD N V NS I + GME Sbjct: 117 SLINGGDGAHAHPTQALLDLFTLKQHLGNVQGKKIAIVGDIKNSRVANSNIELLTRFGME 176 Query: 177 IAVGTPKGYEPDPAAVKFAKENGGKVTIYDDPVRAVSDAHAIYTDTWISMGEEDIKETKL 236 + + P + P P +++ + + D + + + S+ + Sbjct: 177 VILVAPPHFLP-PTSLRTSSSLQEVIDEVDAIMSLRTQTERHKYPIYASLRDYGSDFCIT 235 Query: 237 KDFVGYQLDTALLNKAADDALVLHCLPAHRGEEITDEVIDSMQSGVWDQAENRLHAQKAI 296 KD +G + D L+LH P HR +I+DEV+ + V +Q N + + AI Sbjct: 236 KDLIGDR-----------DILILHPGPVHRNIDISDEVLADPRCKVLEQVRNGVVVRMAI 284 Query: 297 LVRLM 301 LV+L+ Sbjct: 285 LVKLI 289 Lambda K H 0.318 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 291 Length adjustment: 26 Effective length of query: 279 Effective length of database: 265 Effective search space: 73935 Effective search space used: 73935 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory