Align O-succinylhomoserine sulfhydrylase (EC 2.5.1.48) (characterized)
to candidate WP_084276347.1 B8779_RS08955 O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase
Query= reanno::HerbieS:HSERO_RS16440 (413 letters) >NCBI__GCF_900176045.1:WP_084276347.1 Length = 396 Score = 207 bits (527), Expect = 4e-58 Identities = 132/406 (32%), Positives = 211/406 (51%), Gaps = 23/406 (5%) Query: 9 FTTTILHSDRQKGIEHGSLHKPIHTSVTFGYEDARQLAEVFQGKQPGYRYGRQGNPTVAA 68 F T +L +Q + G++ PI S F Y D + VF G+ Y R GNPT A Sbjct: 7 FQTFVL---QQSAAKDGAISPPIIGSAAFSYGDPKSAEAVFAGESRKPLYARMGNPTNAK 63 Query: 69 LEDKITKMEDGKSTICFATGMAAIGAIVQGLLREGDHVVSSAFLFGNTNSLW-MTVGAQG 127 LE + ++ G + ++GM AI A+V L+ GD +V LFG T + + + G Sbjct: 64 LETLLAGIDQGDGAVVTSSGMGAIAAVVSAFLQSGDEIVCVGGLFGGTYAFFTQNLPRFG 123 Query: 128 AKVSMVDATDVKNVEAAITANTRLVFVETIANPRTQVADLKRIGELCRERGILYVVDNTM 187 KV A + E ++ T+++F E++ NP V + ++G+L ++ GIL+VVDNT+ Sbjct: 124 IKVRFFKADE----EVVLSPQTKMIFCESVGNPSLTVVNFVKLGKLAQKHGILFVVDNTI 179 Query: 188 TSPYLFRPKTVGAGLVVNSLTKSIGGHGNALGGAL--TDTGEFDWTRYPHIAENYKKNPA 245 T P LF P + GA ++V S TK I G ALGGA+ + + + +P + +N+ +N Sbjct: 180 T-PLLFEPFSWGADIIVYSTTKVISGQSQALGGAIIYKEPRKDLFIHFPFL-QNFYENLG 237 Query: 246 PQWGMAQIRAKALRDFGGSLGPEAAHHIAVGAETIALRQERECKNALALAQMLQADERVA 305 M I+ +ALRDFG S+ AA+ +G ET+ LR ++ NA L L ++V Sbjct: 238 KDAIMGVIKKRALRDFGMSMQAHAAYLTILGLETLPLRIQKATDNAQKL--FLALKDKVK 295 Query: 306 AVYYPGLESHPQHALSKALFRSFGSLMSFELKDGIDCFDYLNRLRLAIPTSNLGDTRTLV 365 +Y + P G +M + K D F +L ++ T+N+GD+RTL Sbjct: 296 VLYAKNEQYFP---------FGTGQMMGIDFKSKEDAFTFLEHAKIPFITANIGDSRTLA 346 Query: 366 IPVAHTIFYEMGAERRASMGIAESLIRVSVGLEDTDDLVADFRQAL 411 + + TI+ + A +G++E L+R+SVGLE+ ++ DF AL Sbjct: 347 LHMRSTIYRDFKANELEYLGVSEGLVRISVGLENCAMIIEDFENAL 392 Lambda K H 0.319 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 396 Length adjustment: 31 Effective length of query: 382 Effective length of database: 365 Effective search space: 139430 Effective search space used: 139430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory