Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_084471950.1 HALAL_RS0110275 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000527155.1:WP_084471950.1 Length = 413 Score = 227 bits (579), Expect = 9e-64 Identities = 142/411 (34%), Positives = 216/411 (52%), Gaps = 20/411 (4%) Query: 388 VNPIIENVRDKGNSALLEYTEKFDGVKLSNPVLNAPFPEEYFEGLTEEMKEALDLSIENV 447 V+PI++ ++ +G +A+++ E FD VKL + +E + L +++ A SI+ Sbjct: 15 VHPILQAIQARGTTAVIDTVEHFDRVKLETTRVPTSDIKEAVQHLDADLRRAYQTSIDRA 74 Query: 448 RKFHAAQ-LPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVAQ 506 R H AQ +P + +V PG + S P+ +VGLY PGG A L S+ +M VPAQVA Sbjct: 75 RIAHEAQTVPNKRTDVA--PGGVVSERYVPVRRVGLYAPGGLAPLASSVIMNAVPAQVAG 132 Query: 507 CKEIVFASPPRKSDGKVSPE-VVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVDKIL 565 I ASP +K++G + V+ VA +G ++ GG A+ AYGT+ VD + Sbjct: 133 VDSIALASPAQKANGGLPDSGVLAVAGLLGIDEVYAVGGPAAIGMFAYGTDECEPVDVVS 192 Query: 566 GPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHGIDS 625 GPGN +V AAK V+ L ID AG +E+ ++AD AD VA DL+SQAEH + Sbjct: 193 GPGNVYVAAAKRAVRG----LVGIDAEAGTTEIAIVADRTADPAHVAVDLISQAEHDPSA 248 Query: 626 QVILVGVNLS------EKKIQEIQDAVHNQALQLPRVDIVRKCIAHSTIVLCDGYEEALE 679 +L+ + S E+ + + D H++ + S VL EEA+ Sbjct: 249 AAVLITDSPSLASAVDEELAERVPDTRHSERIHTALTG------PQSAAVLVADMEEAIT 302 Query: 680 MSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQY 739 +++ YA EHL + + + + NAG++F+G Y+P S GDY +G+NH LPT G AR Sbjct: 303 VADAYAAEHLEIHTVDPHQVADDIHNAGAIFIGPYSPVSLGDYCAGSNHVLPTGGCARHT 362 Query: 740 SGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRMSK 790 G + TFQ+ I + T E L ++ V+ A E L H A+ R K Sbjct: 363 GGLSVHTFQRAIHVVDYTAEALRDVASDVITFANSEDLPAHGQAIAERFQK 413 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 636 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 413 Length adjustment: 36 Effective length of query: 763 Effective length of database: 377 Effective search space: 287651 Effective search space used: 287651 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory