Align 3-isopropylmalate/3-methylmalate dehydrogenase; 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; IPMDH; Beta-IPM dehydrogenase; D-malate dehydrogenase [decarboxylating]; EC 1.1.1.85; EC 1.1.1.n5; EC 1.1.1.83 (characterized)
to candidate WP_084517751.1 H567_RS0121675 NADP-dependent isocitrate dehydrogenase
Query= SwissProt::Q58130 (333 letters) >NCBI__GCF_000422285.1:WP_084517751.1 Length = 421 Score = 152 bits (384), Expect = 1e-41 Identities = 127/386 (32%), Positives = 177/386 (45%), Gaps = 76/386 (19%) Query: 7 IEGDGIGKEVVPATIQVLEAT-----GLPFEFVYAE--AGDEVYKRTGKA--LPEETIET 57 IEGDG G ++ A V++A G ++ E AG + G LPEET+E Sbjct: 34 IEGDGTGPDIWRAARPVIDAAVRKTYGGKKAILWLELLAGAKAQDALGCECLLPEETLEA 93 Query: 58 ALDCDAVLFGA----AGETAADVIVKLRHILDTYANIRPVKAYKGVKC--LRPD-IDYVI 110 + G G + V LR LD YA IRPV+ G+ P+ +D VI Sbjct: 94 LTRYGIAIKGPLTTPVGGGFRSLNVTLRQRLDLYACIRPVRYVPGIPAPVRHPEKVDLVI 153 Query: 111 VRENTEGLYKGIEAEIDE----------------------------GITIATRVITEKAC 142 RENTE +Y G+E E + GI +R T++ Sbjct: 154 FRENTEDVYAGVEWEAESPAAREILEQINARLSFEGKPLLPIDSAVGIKPMSRRNTQRLV 213 Query: 143 ERIFRFAFNLARERKKMGKEGKVTCAHKANVLKLTDGLFKKIFYKVAEE-YDD------- 194 R ++A + + VT HK N++K T+G F+ Y+ A E + D Sbjct: 214 ARAIQYAADHHYD--------SVTLVHKGNIMKYTEGAFRDWGYQTAREMFGDLTLTEEE 265 Query: 195 -------------IKAEDYYIDAMNMYIITKPQVFDVVVTSNLFGDILSDGAAGTVGGLG 241 I +D DAM ++ +P+ + V+ T NL GD LSD AA VGGLG Sbjct: 266 LFADFGGKAPAGRIVIKDRIADAMFQQLLLRPEEYGVLATPNLNGDYLSDAAAAQVGGLG 325 Query: 242 LAPSANIGDEHGLFEPVHGSAPDIAGKKIANPTATILSAVLMLRYLGEYEAADKVEKALE 301 +AP AN+GD +FE HGSAP AG NP + ILS V MLR++G EAAD + K L Sbjct: 326 MAPGANVGDRCAVFEATHGSAPKYAGLDKVNPGSLILSGVEMLRFMGWDEAADLILKGLR 385 Query: 302 EVLALGLTTPDLGGNLNTFEMAEEVA 327 + + G+ T DL + E A+EV+ Sbjct: 386 DTIGDGIVTYDLARQM---ENAKEVS 408 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 421 Length adjustment: 30 Effective length of query: 303 Effective length of database: 391 Effective search space: 118473 Effective search space used: 118473 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory