Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate WP_084687487.1 OLEAN_RS07045 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase
Query= uniprot:D8IR44_HERSS (295 letters) >NCBI__GCF_000967895.1:WP_084687487.1 Length = 748 Score = 197 bits (502), Expect = 5e-55 Identities = 100/280 (35%), Positives = 160/280 (57%) Query: 4 KVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQGA 63 +V I G+GLIG S+ AL+++ + G R++ S+++A + G+ID + V A Sbjct: 14 RVAIIGLGLIGCSWVKALKKSKSVGLVSGFDRNIDSMQQALQAGLIDDYSLQINDVVNDA 73 Query: 64 DLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAHPI 123 DLI+++ P+ +L I + + I+TD GS K ++ LG+ +F+ HPI Sbjct: 74 DLIIISVPILAVAEVLGQIKSSISEKTILTDVGSVKGNISKDVSKVLGENFDRFVLGHPI 133 Query: 124 AGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDAVF 183 AG E+ G AA L++ K+++T +++V AW+ G ++ +S Q HD V Sbjct: 134 AGSERSGVSAADENLFKRHKIILTPEQRTCERALDLVTDAWKITGGMVELMSVQRHDEVL 193 Query: 184 ASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRDAL 243 A+ SHLPH+LA++LVD +A +F YAA GFRDFTRIA+SSP MWRDI + N+D + Sbjct: 194 AATSHLPHLLAYSLVDTLANDHENNDIFNYAAGGFRDFTRIASSSPIMWRDIFVGNKDEV 253 Query: 244 LTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQW 283 L +D + LQ +R ++A D + + A+ AR + Sbjct: 254 LKALDLFTADLQQLRDVVANEDKTQMMGTFTRAKAARDHF 293 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 748 Length adjustment: 33 Effective length of query: 262 Effective length of database: 715 Effective search space: 187330 Effective search space used: 187330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory