Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate WP_084704786.1 DL88_RS19705 3-dehydroquinate synthase
Query= BRENDA::P07639 (362 letters) >NCBI__GCF_000745425.1:WP_084704786.1 Length = 597 Score = 256 bits (654), Expect = 1e-72 Identities = 161/359 (44%), Positives = 207/359 (57%), Gaps = 10/359 (2%) Query: 2 ERIVVTLGERSYPITIASGLFNEPASFLP-LKSGEQVMLVTNETLAPLYLDKVRGVLEQA 60 E + V LG RSY I I L E + + L +VT+E +A +L + L Sbjct: 230 EIVPVDLGPRSYKIHIGPDLIAEAGALIAALDPKAACAIVTDENVAREHLPALEQSLRNQ 289 Query: 61 GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR 120 G+ +++++ GE KS A V A++ R +VALGGG+VGDL GF AAS +R Sbjct: 290 GIRYETIVVRPGEGSKSFATFAEVCDAVIAGKFERRDLIVALGGGIVGDLAGFVAASVRR 349 Query: 121 GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS 180 G+RF+QVPTTLLSQVDSSVGGKT +N P GKN+IGAF+QP+ V+ D L+TLP RE + Sbjct: 350 GMRFVQVPTTLLSQVDSSVGGKTGINSPHGKNLIGAFHQPSLVLADSAVLETLPKREFRA 409 Query: 181 GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR 240 G AEV+KYG+I D AFF WLE + + + G + I C KA +V DE ETG R Sbjct: 410 GYAEVVKYGLINDPAFFVWLEVHWPNVFQ-GGVDRVHAIATSCRAKAAIVKRDEFETGDR 468 Query: 241 ALLNLGHTFGHAIEAEMGYG--NWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLK 298 ALLNLGHTFGHA EA + +HGE VA GM A R S R G S+ + R+ L+ Sbjct: 469 ALLNLGHTFGHAFEALTHFDGIRLVHGEGVAIGMACAFRFSVRRGYCSAEDALRVENHLR 528 Query: 299 RAGLPVNGPREMS-----AQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELV 352 GLP + RE+S A A L M +DKKV G + IL IG V V + V Sbjct: 529 AVGLPTH-IREISDFDADAAAILAAMYQDKKVERGALTFILARGIGDCFVEKKVEGDEV 586 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 452 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 597 Length adjustment: 33 Effective length of query: 329 Effective length of database: 564 Effective search space: 185556 Effective search space used: 185556 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_084704786.1 DL88_RS19705 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.25903.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-113 364.9 0.0 2.7e-113 364.6 0.0 1.1 1 lcl|NCBI__GCF_000745425.1:WP_084704786.1 DL88_RS19705 3-dehydroquinate sy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_000745425.1:WP_084704786.1 DL88_RS19705 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 364.6 0.0 2.7e-113 2.7e-113 1 341 [. 241 588 .. 241 591 .. 0.96 Alignments for each domain: == domain 1 score: 364.6 bits; conditional E-value: 2.7e-113 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKslet 67 yk+++g +l++++ + +a + ++tde+v++++ le+ l+++g++ +++vv +ge sKs++t lcl|NCBI__GCF_000745425.1:WP_084704786.1 241 YKIHIGPDLIAEAGALIAAldPKAACAIVTDENVAREHLPALEQSLRNQGIRYETIVVRPGEGSKSFAT 309 78*********9999999965458899****************************************** PP TIGR01357 68 vaklldqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlpl 136 +a++ d++++ k+er++++va+GGG+vgDlaGFvAa+ RG+r+vqvPTtll++vDssvGGKtgin p+ lcl|NCBI__GCF_000745425.1:WP_084704786.1 310 FAEVCDAVIAGKFERRDLIVALGGGIVGDLAGFVAASVRRGMRFVQVPTTLLSQVDSSVGGKTGINSPH 378 ********************************************************************* PP TIGR01357 137 gkNliGafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealee 205 gkNliGaf+qP++Vl d +vletlp+re+r+G+aEv+K+gli+d ++f +le ++ ++ + + lcl|NCBI__GCF_000745425.1:WP_084704786.1 379 GKNLIGAFHQPSLVLADSAVLETLPKREFRAGYAEVVKYGLINDPAFFVWLEVHWPNVFQ--GGVDRVH 445 *******************************************************98875..4456678 PP TIGR01357 206 likrsievKaevVeeDekesglRalLNfGHtlgHaiEallkyk...lsHGeaVaiGmvveaklseklgl 271 +i+ s++ Ka +V++De e+g RalLN+GHt+gHa Eal++++ l HGe VaiGm++++++s + g+ lcl|NCBI__GCF_000745425.1:WP_084704786.1 446 AIATSCRAKAAIVKRDEFETGDRALLNLGHTFGHAFEALTHFDgirLVHGEGVAIGMACAFRFSVRRGY 514 99***************************************9999999********************* PP TIGR01357 272 lkaellerlvallkklglptklkk....klsveellkallkDKKnegskiklvlleeiGkaalasevte 336 ++ae++ r+++ l+++glpt++++ + ++ ++l+a+ +DKK e++ ++++l++ iG+++++++v lcl|NCBI__GCF_000745425.1:WP_084704786.1 515 CSAEDALRVENHLRAVGLPTHIREisdfDADAAAILAAMYQDKKVERGALTFILARGIGDCFVEKKVEG 583 ************************9988899999******************************99987 PP TIGR01357 337 eelle 341 +e+++ lcl|NCBI__GCF_000745425.1:WP_084704786.1 584 DEVKA 588 77665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (597 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.65 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory