Align N-succinyldiaminopimelate-aminotransferase (EC 2.6.1.17) (characterized)
to candidate WP_085121937.1 B9O00_RS07990 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
Query= metacyc::MONOMER-6501 (397 letters) >NCBI__GCF_900177295.1:WP_085121937.1 Length = 415 Score = 223 bits (568), Expect = 8e-63 Identities = 149/388 (38%), Positives = 195/388 (50%), Gaps = 15/388 (3%) Query: 12 PFEKLRALLADAGKPTHDLP---PINLSIGEPKHAAPACVGQAIAANLAGLSVYPSTKGE 68 PF KL LLA LP PINL++G+P+ APA + + IAA G S YP +G Sbjct: 27 PFLKLGRLLAGIAPGRSPLPDGTPINLAVGDPQQPAPALLSETIAAYPNGWSSYPPFRGT 86 Query: 69 PALRQAISQWLSRRYSIPAPDPESE--VLPVLGSREALFAFAQTVIDPSAGA---LVVCP 123 P +QA WL+RRY +P E E VLP+ GSRE LF + + A V+ P Sbjct: 87 PEYQQAAVDWLARRYGLPEGFIEGERHVLPIPGSREGLFFAGLSALSLGAAEGRDRVLLP 146 Query: 124 NPFYQIYEGAALLAGATPYYVNADPARDFGLRTGRVPDEVWRRTQLVFVCSPGNPAGNVM 183 P Y +Y GAA AGA P +V A F + + RT + FVC+P NP G Sbjct: 147 APGYHVYAGAAAAAGAEPVFVPATRETGFLPDFAALDPAILDRTAIAFVCAPSNPEGAAA 206 Query: 184 SLEEWRTLFELSDRHGFVIAAYECYSEIYLDEDTPPLGSLQAARRLGRDRYTNLVAFSSL 243 L WR L L+ RHGF++AA ECY+EIY E PP G+LQAA G NL+ F SL Sbjct: 207 DLPRWRALLALARRHGFLLAADECYAEIYFGE--PPAGALQAALETG--SLDNLLVFHSL 262 Query: 244 SKRSNVPGMRSGFVAGDAALLARFLLYRTYHGSAMSPVVSAASIAAWS-MRRMCRKTAQY 302 SKRSN G+R GF+AGD L+ + + G++++ V A A W+ A Y Sbjct: 263 SKRSNAAGLRCGFLAGDPGLVDAVEAFCRFGGASVALPVLQAGAALWNDDGHAAVNRAFY 322 Query: 303 RAKFEAVLPILQNVLDVRAPQASFYLWAGTPGSDTAFARELYGRTGVTVLPGS-LLAREA 361 FE + P F+LW G D A A L+ G+ LPGS ++A Sbjct: 323 ANLFERAEATIGGRFGWSKPDGGFFLWLQV-GDDEAAAVRLWREAGIRTLPGSYMVADTT 381 Query: 362 HNANPGQGRIRIALVAPLDQCVQAAERI 389 NP G +R+A+V V A ER+ Sbjct: 382 LQPNPAAGFLRVAMVFDETVTVPALERL 409 Lambda K H 0.321 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 33 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 415 Length adjustment: 31 Effective length of query: 366 Effective length of database: 384 Effective search space: 140544 Effective search space used: 140544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory