Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (characterized)
to candidate WP_085770152.1 B1812_RS02260 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Query= CharProtDB::CH_024869 (274 letters) >NCBI__GCF_002117405.1:WP_085770152.1 Length = 285 Score = 338 bits (867), Expect = 8e-98 Identities = 179/280 (63%), Positives = 210/280 (75%), Gaps = 13/280 (4%) Query: 4 LQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKIDGQ-----WVTHQW 58 L+++I AFE RA ITP+ + R AV + LLD G LRVAEKI+G+ W HQW Sbjct: 6 LESLITAAFEDRANITPSTQGDI-RHAVESALRLLDCGKLRVAEKIEGEEGPASWRVHQW 64 Query: 59 LKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAF 116 LKKAVLLSFR+ND VI G + ++DKVP KF + GFR VP A VR A+ Sbjct: 65 LKKAVLLSFRLNDMNVIAGGPGGATWWDKVPSKFTGWGAKEHADGGFRSVPGAIVRHSAY 124 Query: 117 IARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 176 +A +LMPS+VN+GAYVD GTMVDTW TVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT Sbjct: 125 VAPGAILMPSFVNLGAYVDSGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 184 Query: 177 IIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSG 236 IIED+CFIGARSEVVEGV++ +GSV+SMGV+IG ST++ DR TG++H G VP SVVVSG Sbjct: 185 IIEDDCFIGARSEVVEGVVIGKGSVLSMGVFIGASTKVIDRSTGKVHVGYVPPYSVVVSG 244 Query: 237 NLPSK---DGKY--SLYCAVIVKKVDAKTRGKVGINELLR 271 N+P K DG+ SLYCAVIVK VDA+TR K GINELLR Sbjct: 245 NIPGKSLPDGQSGPSLYCAVIVKTVDAQTRAKTGINELLR 284 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 10 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 285 Length adjustment: 26 Effective length of query: 248 Effective length of database: 259 Effective search space: 64232 Effective search space used: 64232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate WP_085770152.1 B1812_RS02260 (2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase)
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00965.hmm # target sequence database: /tmp/gapView.20855.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00965 [M=271] Accession: TIGR00965 Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-124 398.6 0.1 8.1e-124 398.4 0.1 1.0 1 lcl|NCBI__GCF_002117405.1:WP_085770152.1 B1812_RS02260 2,3,4,5-tetrahydro Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002117405.1:WP_085770152.1 B1812_RS02260 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransf # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 398.4 0.1 8.1e-124 8.1e-124 3 269 .. 7 284 .. 5 285 .] 0.94 Alignments for each domain: == domain 1 score: 398.4 bits; conditional E-value: 8.1e-124 TIGR00965 3 qkiietaferraeilpasklikvkeavnesiasldsgalrvaekldgq.....wkvnewvkkavllsfr 66 i afe ra+i+p+++ ++++av+ +++ ld g+lrvaek++g+ w+v++w+kkavllsfr lcl|NCBI__GCF_002117405.1:WP_085770152.1 7 ESLITAAFEDRANITPSTQ-GDIRHAVESALRLLDCGKLRVAEKIEGEegpasWRVHQWLKKAVLLSFR 74 567999**********875.689**********************76445555**************** PP TIGR00965 67 itdnqvlnda..vnkyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvd 133 ++d +v+ ++ + ++dkv++kf+ + +e + g+r vpga+vr+ a++a +lmps+vn+gayvd lcl|NCBI__GCF_002117405.1:WP_085770152.1 75 LNDMNVIAGGpgGATWWDKVPSKFTGWGAKEHADGGFRSVPGAIVRHSAYVAPGAILMPSFVNLGAYVD 143 *******98622689****************************************************** PP TIGR00965 134 egtmvdtwatvgscaqigknvhlsggvgiggvleplqakpviiedncfigarseivegviveegsvism 202 gtmvdtw tvgscaqigknvhlsggvgiggvleplqa+p+iied+cfigarse+vegv++ +gsv+sm lcl|NCBI__GCF_002117405.1:WP_085770152.1 144 SGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDDCFIGARSEVVEGVVIGKGSVLSM 212 ********************************************************************* PP TIGR00965 203 gvfigqstkivdretgeiiygrvpagsvvvsgslpsk...dgk..kslycavivkkvdaktrgkvsine 266 gvfig stk++dr+tg+++ g vp +svvvsg++p k dg+ +slycavivk vda+tr+k++ine lcl|NCBI__GCF_002117405.1:WP_085770152.1 213 GVFIGASTKVIDRSTGKVHVGYVPPYSVVVSGNIPGKslpDGQsgPSLYCAVIVKTVDAQTRAKTGINE 281 *********************************99864445653379********************** PP TIGR00965 267 llr 269 llr lcl|NCBI__GCF_002117405.1:WP_085770152.1 282 LLR 284 **9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (271 nodes) Target sequences: 1 (285 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.66 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory