Align prephenate dehydratase (EC 4.2.1.51) (characterized)
to candidate WP_085770325.1 B1812_RS03260 prephenate dehydratase
Query= BRENDA::Q5NLV8 (337 letters) >NCBI__GCF_002117405.1:WP_085770325.1 Length = 287 Score = 245 bits (625), Expect = 1e-69 Identities = 135/280 (48%), Positives = 183/280 (65%), Gaps = 9/280 (3%) Query: 60 VAFQGAPGCNSNIAIQDLFPDSLPLPCFSFADALTAVKEGRAGRAMIPIENSLNGRVADM 119 +A+QG PG NS+IA ++ +P PLPC SF DA AV G A AMIPIENS+ GRVAD+ Sbjct: 5 IAYQGEPGANSDIACREAYPHLAPLPCASFEDAFAAVSSGEASLAMIPIENSIAGRVADI 64 Query: 120 HFLLPESGLTIQAEYFLPINHCLVAPKGAGE--ITHVLSHPQALGQCRHWLQAHNLRALA 177 H LP SGL I AEYFLP++ L+APKGA + V SH ALGQCR ++ L A Sbjct: 65 HHFLPHSGLHIVAEYFLPVHFQLMAPKGATREGLKSVYSHVHALGQCRKIVEELQLIAHT 124 Query: 178 HADTAGAAAEVADRKQAGLAALSPALAAKLYGLEILEKGIADGDTNITRFVVLAEADTAL 237 DTAGAA EV++ + AAL+P LAA++YGL++L + + D + N TRF+VL++ Sbjct: 125 AGDTAGAAREVSEWGDSTKAALAPWLAAEIYGLDVLGEDVEDEEHNTTRFIVLSKT---- 180 Query: 238 QDLPPIRQNLSGKMMTSLLFTVKNTPSALLNAIKGFGDNQVNMTKLESYQHGASFSATQF 297 PP+ + G+ +T+ +F V+N P+AL + GF N VNMTK+ESY F+AT+F Sbjct: 181 PQWPPVGE---GQTITTFIFRVRNVPAALYKTLGGFATNGVNMTKIESYMVDGEFAATRF 237 Query: 298 YADVEGEPSEDNVARALDILQENACDLRILGVYAQARPRQ 337 ADVEG P E ++RAL+ L+ + ++ ILGVY AR R+ Sbjct: 238 LADVEGHPEEPALSRALEELRFFSREVEILGVYPAARFRE 277 Lambda K H 0.318 0.132 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 238 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 287 Length adjustment: 27 Effective length of query: 310 Effective length of database: 260 Effective search space: 80600 Effective search space used: 80600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory