Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate WP_085771629.1 B1812_RS10970 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >NCBI__GCF_002117405.1:WP_085771629.1 Length = 384 Score = 237 bits (604), Expect = 5e-67 Identities = 142/376 (37%), Positives = 197/376 (52%), Gaps = 18/376 (4%) Query: 9 KLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGYIISG 68 +LV F + N D+++ + YL G++ +P GD++ +FATIGP G ++SG Sbjct: 13 RLVSFDTESAKSNLDLIADVEAYLREQGVSFVRIPNAAGDKAALFATIGPHVEGGVLLSG 72 Query: 69 HMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPLHLA 128 H DVVP W++DPF+LR E +RL GRG DMKGF A LA +P+ A L+RP+H+ Sbjct: 73 HTDVVPVTGQAWSADPFKLRREGERLIGRGAVDMKGFDAVCLAMIPEFKAAALKRPIHIL 132 Query: 129 LSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRSGHS 188 LSYDEE C G I R QP I+GEPT M+ AHK VRG HS Sbjct: 133 LSYDEETTCVGPIDAIRRFGHDLPQPGAVIVGEPTSMQVADAHKSVTTYTTHVRGFEVHS 192 Query: 189 SRPDQGLNAIHGVAGVL--TQAVAEADRLVGGPFEHVFEPPYSSLQIGTVKGGQAVNIIP 246 + G++A+H ++ + + A R G P F+PPYSS+ +G + GG A NI+ Sbjct: 193 ANLHTGVSAVHVACRLVCELERIGAALREEGDPSGR-FDPPYSSIHVGVISGGTARNIVA 251 Query: 247 DSCEVEFEARAISGVDPAELLAPVRKTAEALTTL--------GFEVEWQELSAYPALSLE 298 C +E R G+ A + ++ A + TL G VE + P L+ + Sbjct: 252 RDCAFNWEFR---GLPQAPMHLAQQRLAAFVETLAPQFAAFPGTGVETITEAEVPGLAPQ 308 Query: 299 PDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILIDEL 358 P + L L +V Y +EAG FQR G A+ICGPG I AH+PDE+I I +L Sbjct: 309 PGSGAEVLALRLARANRTISVPYASEAGRFQRGGTPAVICGPGRIDEAHQPDEFIEIAQL 368 Query: 359 MAC----RAMVEALGA 370 AC R +V L A Sbjct: 369 AACVDFMRGLVRELSA 384 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 384 Length adjustment: 30 Effective length of query: 344 Effective length of database: 354 Effective search space: 121776 Effective search space used: 121776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_085771629.1 B1812_RS10970 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.21487.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-107 345.2 0.1 2.6e-107 345.0 0.1 1.0 1 lcl|NCBI__GCF_002117405.1:WP_085771629.1 B1812_RS10970 acetylornithine de Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002117405.1:WP_085771629.1 B1812_RS10970 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 345.0 0.1 2.6e-107 2.6e-107 4 364 .. 12 378 .. 9 379 .. 0.94 Alignments for each domain: == domain 1 score: 345.0 bits; conditional E-value: 2.6e-107 TIGR01892 4 akLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvvP 72 ++Lv+fd+ sa+sn+dli ve+yl+e+gv+ ++p+a g +k l+a+iGp++ +gg++lsGhtDvvP lcl|NCBI__GCF_002117405.1:WP_085771629.1 12 ERLVSFDTESAKSNLDLIADVEAYLREQGVSFVRIPNAAG-DKAALFATIGPHV-EGGVLLSGHTDVVP 78 68**************************************.************9.9************* PP TIGR01892 73 vdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkl 141 v ++aW++Dpf+L+ + +rL grG+ DmkGF a+ La +p+ +aa Lk+P+h++ls+Dee+++ G + lcl|NCBI__GCF_002117405.1:WP_085771629.1 79 VTGQAWSADPFKLRREGERLIGRGAVDMKGFDAVCLAMIPEFKAAALKRPIHILLSYDEETTCVGPIDA 147 ********************************************************************* PP TIGR01892 142 ieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvala 207 i + ++p +ivGePts++ ahk + +vrG e hs++ ++Gvsa+++a +l+ +l++ lcl|NCBI__GCF_002117405.1:WP_085771629.1 148 IRRFGhdlPQPGAVIVGEPTSMQVADAHKSVTTYTTHVRGFEVHSANLHTGVSAVHVACRLVCELERIG 216 999877889************************************************************ PP TIGR01892 208 dklkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee...v 272 l++ +d+ F+ppy+++++G++ GG+a ni+a+ C ++ e+R +p +++ ++ l + e+ lcl|NCBI__GCF_002117405.1:WP_085771629.1 217 AALREeGDPSGRFDPPYSSIHVGVISGGTARNIVARDCAFNWEFRGLPQAPMHLAQQRLAAFVETlapQ 285 ***98789*************************************999876654444444444431115 PP TIGR01892 273 kekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPGdid 340 + pg++v++ + p+l++++ + ++ l+ +la a ++ v+y++eag +q+ G++av++GPG id lcl|NCBI__GCF_002117405.1:WP_085771629.1 286 FAAFPGTGVETITEAEVPGLAPQPGSGAEVLALRLARAnRTISVPYASEAGRFQRGGTPAVICGPGRID 354 5889**********************99999999887769999************************** PP TIGR01892 341 qahqpdeYveieelkrcrallerl 364 +ahqpde++ei +l +c ++++ l lcl|NCBI__GCF_002117405.1:WP_085771629.1 355 EAHQPDEFIEIAQLAACVDFMRGL 378 ********************9976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory