Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_085772117.1 B1812_RS13860 acetylglutamate kinase
Query= BRENDA::Q87EL2 (421 letters) >NCBI__GCF_002117405.1:WP_085772117.1 Length = 292 Score = 105 bits (261), Expect = 2e-27 Identities = 86/286 (30%), Positives = 132/286 (46%), Gaps = 17/286 (5%) Query: 1 MASAKEISQYLKRFSQLDAKRFAVVKVGGAVLRDDVDA--LTSSLSFLQEVGLTPIVLHG 58 + A+ ++Q L + D VVK GG + DD A + L++ G+ P+V+HG Sbjct: 10 LKQAEILTQALPHMLRYD-DAIVVVKYGGHAMGDDSVARDFARDMVLLEQSGVNPVVVHG 68 Query: 59 AGPQLDEELTAVGIQKKTVNGFRVTLPETMAIVRKVFH-ATNLQLIEALQRNGARATSIT 117 GPQ+ L +GI +G RVT TM I V A N Q++ + G RA + Sbjct: 69 GGPQIGAMLKKLGIASHFSDGLRVTDKATMDIAEMVLAGAINKQIVGFINAEGGRAIGLC 128 Query: 118 GG---------VFEAHYLDQETYGLVGGISAVNIAPIEASLRAASIPVIASLGETPSGQI 168 G + D G VG V+ ++ L IPV+A + + +G Sbjct: 129 GKDGRMVTAAKLARPGASDGVDLGFVGEPVKVDTTVLDQVLGRELIPVLAPVAQGQNGDT 188 Query: 169 LNINADVAANELVHVLQPYKIIFLTGTGGLLDADGKIINSINLSTEYEQLIQQPWVYGGM 228 NINAD A + L +++FLT G+LD D K+I + ++ + LI + GGM Sbjct: 189 YNINADTFAGAIAGALGAKRLLFLTDVPGVLDKDKKLIEQLKIA-DIPGLIADGTITGGM 247 Query: 229 KLKIEQIKHLLDRLPLESSVSI--TRPADLAKELFTHKGSGTLIRR 272 K+E + ++R +E V + P + EL T G+GTLI R Sbjct: 248 IPKVETCMYAVER-GVEGVVILDGKLPHAVLIELLTDHGAGTLITR 292 Lambda K H 0.320 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 292 Length adjustment: 29 Effective length of query: 392 Effective length of database: 263 Effective search space: 103096 Effective search space used: 103096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory