Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_089299774.1 CHB84_RS02235 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_900188115.1:WP_089299774.1 Length = 342 Score = 118 bits (295), Expect = 2e-31 Identities = 81/236 (34%), Positives = 114/236 (48%), Gaps = 35/236 (14%) Query: 14 VIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFLLAFLG 73 V+DRL +P GCPWD QT ESL YLVEE +EL+EAI +G+ + +REE+GDV+ + F Sbjct: 118 VMDRLRSPGGCPWDGIQTHESLRQYLVEETYELLEAIETGDRESLREELGDVLLQVLFHA 177 Query: 74 RLYA--DKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLR----NWESIKRAEKA 127 RL A D F +D A+ K++ RHPHVF+ + A+ WE +KR EK Sbjct: 178 RLAAEHDTDPFDIDAVAADLVTKLVSRHPHVFTGSAGAESGHTAERQQVRWEELKRTEKG 237 Query: 128 DAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLAG 187 + D + P + A ++ ++AR G PE ELL G Sbjct: 238 -----RESAVDGVALGQPAVALAAKLAQRSARAGV--PE-------------ELLPAPEG 277 Query: 188 DDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLD 243 G +F + +R G AL + +FL R E+ ARE G+D Sbjct: 278 ---------TGAALFDIAARAKRAGEDPEDALRVVAKRFLADMRAAESSAREAGID 324 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 342 Length adjustment: 27 Effective length of query: 240 Effective length of database: 315 Effective search space: 75600 Effective search space used: 75600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory