Align methanogen homoaconitase (EC 4.2.1.114) (characterized)
to candidate WP_089299975.1 CHB84_RS03300 3-isopropylmalate dehydratase large subunit
Query= BRENDA::Q58409 (420 letters) >NCBI__GCF_900188115.1:WP_089299975.1 Length = 492 Score = 222 bits (566), Expect = 2e-62 Identities = 154/469 (32%), Positives = 240/469 (51%), Gaps = 57/469 (12%) Query: 2 TLVEKILSKKVGYEVCAGDSIEVE---VDLAMTHDGTTPLAYKALKEMSDSVWNPDKIVV 58 TL EKI V V G+ E + +DL + H+ T+P A++ L+ V PD + Sbjct: 28 TLAEKIWDAHV---VRHGEGAEPDLLYIDLHLVHEVTSPQAFEGLRLAGRKVRRPDLTIA 84 Query: 59 AFDHNVPP--------NTVKAAEMQKLALEFVKRFGIKNFHKGG--EGICHQILAE-NYV 107 DHNVP + V ++ L + FG++ G +GI H I + Sbjct: 85 TEDHNVPTVDTHLPIADPVSRTQVDTLRSN-CEEFGVRLHPMGDTEQGIVHVIGPQLGLT 143 Query: 108 LPNMFVAGGDSHTCTHGAFGAFATGFGATDMAYIYATGETWIKVPKTIRVDIVGK-NENV 166 P M V GDSHT THGAFGA A G G +++ ++ AT ++ KT+ V++ G+ V Sbjct: 144 QPGMTVVCGDSHTSTHGAFGAMAFGIGTSEVEHVLATQTLPLRPFKTMAVNVNGELRPGV 203 Query: 167 SAKDIVLRVCKEIGRRGATYMAIEYGGEVVKNMDMDGRLTLCNMAIEMGGKTGVIEADEI 226 +AKDI+L V +IG G +EY G ++++ M+ R+T+CNM+IE G + G+I DE Sbjct: 204 TAKDIILAVIAKIGTGGGQGYVLEYRGSAIESLSMEARMTICNMSIEAGARAGMIAPDET 263 Query: 227 TYDYLKKE----RGLSDEDIAKLKKERITVNRDEANYYKEIEIDITDMEEQVAVPHHPDN 282 T+ YL+ G +D + + R +A + E++ID + + V +P Sbjct: 264 TFRYLQARPHAPAGAQWDD--AVAEWRALCTDPDAEFDVEVDIDASRLTPFVTWGTNPGQ 321 Query: 283 VKPISD--------VEGTE-----------------------INQVFIGSCTNGRLSDLR 311 P+S+ + TE ++ VF+GSCTNGR+ DLR Sbjct: 322 GLPLSESVPDPELIADETERFAAEKALSYMGLEAGTPLRDIAVDTVFLGSCTNGRIEDLR 381 Query: 312 EAAKYLKGREVHKDVKLIVIPASKKVFLQALKEGIIDIFVKAGAMICTPGCGPCLGAHQG 371 AA+ L+G +V ++V+++V+P S +V A EG+ +F++AGA GC CLG + Sbjct: 382 AAAEVLRGHKVAENVQMLVVPGSMRVREAAEAEGLDTVFLEAGAQWRQAGCSMCLGMNPD 441 Query: 372 VLAEGEICLSTTNRNFKGRMGHINSYIYLASPKIAAISAVKGYITNKLD 420 L+ GE ST+NRNF+GR G +L SP +AA +AV+G + + D Sbjct: 442 QLSPGERSASTSNRNFEGRQGE-GGRTHLVSPLVAAATAVRGTLASPED 489 Lambda K H 0.318 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 420 Length of database: 492 Length adjustment: 33 Effective length of query: 387 Effective length of database: 459 Effective search space: 177633 Effective search space used: 177633 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory