Align chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_089300161.1 CHB84_RS04200 chorismate mutase
Query= BRENDA::P9WIC1 (105 letters) >NCBI__GCF_900188115.1:WP_089300161.1 Length = 103 Score = 105 bits (263), Expect = 1e-28 Identities = 53/96 (55%), Positives = 71/96 (73%) Query: 9 ENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGTR 68 E AE + +++ ++D LR+EID LD EIL L+KRR +VS+ IG ARMA+GGTR Sbjct: 7 EGAEHDEEPVSDVDTAETADVDQLRDEIDWLDDEILRLIKRRVDVSRRIGAARMAAGGTR 66 Query: 69 LVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLG 104 +V++REM V+ RY ELGP+G+ LA+ LL LGRGRLG Sbjct: 67 IVYNREMDVLTRYGELGPEGRQLAMALLNLGRGRLG 102 Lambda K H 0.317 0.136 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 45 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 105 Length of database: 103 Length adjustment: 11 Effective length of query: 94 Effective length of database: 92 Effective search space: 8648 Effective search space used: 8648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 40 (20.0 bits)
Align candidate WP_089300161.1 CHB84_RS04200 (chorismate mutase)
to HMM TIGR01808 (chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01808.hmm # target sequence database: /tmp/gapView.14214.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01808 [M=74] Accession: TIGR01808 Description: CM_M_hiGC-arch: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-31 94.1 0.3 2.7e-31 93.8 0.3 1.1 1 lcl|NCBI__GCF_900188115.1:WP_089300161.1 CHB84_RS04200 chorismate mutase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089300161.1 CHB84_RS04200 chorismate mutase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.8 0.3 2.7e-31 2.7e-31 2 74 .] 27 99 .. 26 99 .. 0.98 Alignments for each domain: == domain 1 score: 93.8 bits; conditional E-value: 2.7e-31 TIGR01808 2 ikklReEidrlDaeilslvKrRleisqaiGKirkesggtrlvrkREvevierfaelGeegkelaellLrlg 72 +++lR+Eid lD eil l+KrR+++s+ iG +r++ ggtr v +RE++v+ r+ elG+eg++la lL+lg lcl|NCBI__GCF_900188115.1:WP_089300161.1 27 VDQLRDEIDWLDDEILRLIKRRVDVSRRIGAARMAAGGTRIVYNREMDVLTRYGELGPEGRQLAMALLNLG 97 799******************************************************************** PP TIGR01808 73 rg 74 rg lcl|NCBI__GCF_900188115.1:WP_089300161.1 98 RG 99 97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (74 nodes) Target sequences: 1 (103 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.33 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory