Align succinyldiaminopimelate transaminase (EC 2.6.1.17) (characterized)
to candidate WP_089300381.1 CHB84_RS05330 putative succinyldiaminopimelate transaminase DapC
Query= BRENDA::P9WPZ5 (397 letters) >NCBI__GCF_900188115.1:WP_089300381.1 Length = 391 Score = 461 bits (1186), Expect = e-134 Identities = 238/388 (61%), Positives = 281/388 (72%), Gaps = 11/388 (2%) Query: 3 VSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPG 62 V LRP+A+T+FAEM+ALATR AVNLGQGFPD DGP ML A DAI G NQYPPGPG Sbjct: 7 VPALRPFASTIFAEMTALATRTSAVNLGQGFPDTDGPAGMLDAVHDAIDNGANQYPPGPG 66 Query: 63 SAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSY 122 LR A++ R+R FGV+YDP+TEVLVT GATEAIAA++L L G +VL+IEP+YDSY Sbjct: 67 RPELRAAVSEHRKR-FGVEYDPDTEVLVTTGATEAIAASLLALTSRGDDVLVIEPYYDSY 125 Query: 123 SPVVAMAGAHRVTVPLVPDGRG--FALDADALRRAVTPRTRALIINSPHNPTGAVLSATE 180 VAMAGA R VPL D F LD AL A+T TRA+I+NSPHNPTG V + E Sbjct: 126 VAAVAMAGARRRVVPLHLDENSGRFELDVAALEAAITDSTRAIIVNSPHNPTGTVFTHAE 185 Query: 181 LAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWK 240 LAA+AE+ V +L+ I+DEVYEHLVFD H+P+A GMA RT+TISSA K+FNCTGWK Sbjct: 186 LAALAELCVRHDLIAISDEVYEHLVFDDTEHVPVATLPGMAGRTVTISSAGKIFNCTGWK 245 Query: 241 IGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAA 300 IGWACG +LIA VRAAKQ+L++V G PFQPAVA AL E WV R +L +RDRL+A Sbjct: 246 IGWACGNRDLIAAVRAAKQFLTFVSGGPFQPAVAHALRAELDWVEQSRAALGDKRDRLSA 305 Query: 301 GLTEIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGQAS 360 GL E GF+V GTYF+CAD RPLGY D+T+ ALPE+VGVAA+P+S F + AG Sbjct: 306 GLAEAGFSVLPCSGTYFVCADVRPLGYSDATDLAWALPERVGVAAVPVSVFTENGAGN-- 363 Query: 361 QQADVWNHLVRFTFCKRDDTLDEAIRRL 388 HL+RF FCKRDD LD AI RL Sbjct: 364 ------THLLRFAFCKRDDVLDTAIERL 385 Lambda K H 0.321 0.135 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 503 Number of extensions: 22 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 391 Length adjustment: 31 Effective length of query: 366 Effective length of database: 360 Effective search space: 131760 Effective search space used: 131760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory