Align Homoaconitase large subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate WP_089300736.1 CHB84_RS07295 aconitate hydratase
Query= SwissProt::Q9ZNE0 (418 letters) >NCBI__GCF_900188115.1:WP_089300736.1 Length = 650 Score = 196 bits (499), Expect = 1e-54 Identities = 135/423 (31%), Positives = 209/423 (49%), Gaps = 14/423 (3%) Query: 1 MGQTLAEKILS-HKVGRPVRAGELVVVEVDQVMVVDSIAGSFFKRLEYLEATPRYPERVS 59 M + +A+K+++ H + + GE + + +D + D+ + LE L E Sbjct: 1 MARNVAQKVIAAHLISGSMEPGEEIALAIDHTLTQDATGTLVMQELEALGLDRARTEVSV 60 Query: 60 IVIDHVAPAANLEVAKAQKEIREWGKRHGIRVFDVGRGVCHQVLIEEGLAQPGWVVVGSD 119 +DH + A+ + R+G+ G GV H ++ PG +VGSD Sbjct: 61 QYVDHNLLQTDERNAEDHTFLHSACSRYGLWFSKPGNGVSHPTHMQR-FGVPGKTMVGSD 119 Query: 120 SHSTTYGAVGAFGTGMGATDIALAAASGRTWLRVPESVKVVFRGRLPKGVTAKDAALEMV 179 SH+ G++G G+G ++A+A A +LR+PE V G LP V+AKD LEM+ Sbjct: 120 SHTPAAGSLGMLAMGVGGLEVAMAIAGRPLYLRMPEIWGVRLTGSLPPWVSAKDVILEML 179 Query: 180 RLLTAEGATYMAVEIHLLDGAEALTRGERMTLANLTVEAGAKAGLVVPSGEILEMY---- 235 R T G +E H G E L+ +R +AN+ E GA + P+ E + + Sbjct: 180 RRHTVAGGVNRIIEYHG-PGLEGLSAMDRHVIANMGAELGATT-TIFPADEAVREFLDAE 237 Query: 236 -RVPDW--LYPDPDARYAKEVEIDLSALTPRVSVPFYVDNVHEVAQVKGKRVDQVFIGTC 292 R D+ + D A Y EIDLS+L P ++ P DN+ EV++V+G V QV IG+ Sbjct: 238 DRASDFVPIAADEGATYDVTEEIDLSSLVPLIAKPSAPDNIVEVSEVQGTEVSQVVIGSS 297 Query: 293 TNGRIEDLRAAAEVLRGRKVAPWVRLLVVPASSQVLEEAARDGTLLTLLEAGATIGTPGC 352 N + D AA ++RGR+ + V P+S ++ + + G L+ AGA I GC Sbjct: 298 ANPGLRDFAVAAAMVRGRQTHDAISFDVNPSSREIFADLTKMGATFDLISAGARIHQAGC 357 Query: 353 GPCMGRHMG-VLAPGEVCVSTSNRNFRGRMGAPDAEIYLASPRVAAASAVAGYLTTPEEL 411 C+G MG A G+ + T RNF GR G + ++L SP AAA+A+ G +T P EL Sbjct: 358 MGCIG--MGQAPAVGQNSLRTFPRNFPGRSGTKEDSVWLCSPETAAAAALTGVITDPREL 415 Query: 412 EEE 414 E+ Sbjct: 416 AEK 418 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 567 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 650 Length adjustment: 35 Effective length of query: 383 Effective length of database: 615 Effective search space: 235545 Effective search space used: 235545 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory