Align putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (EC 3.5.4.19; EC 3.6.1.31) (characterized)
to candidate WP_089300783.1 CHB84_RS07575 phosphoribosyl-AMP cyclohydrolase
Query= metacyc::HISTCYCLOPRATPPHOS (203 letters) >NCBI__GCF_900188115.1:WP_089300783.1 Length = 121 Score = 85.1 bits (209), Expect = 5e-22 Identities = 38/90 (42%), Positives = 56/90 (62%) Query: 16 DGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQRLWTKGETSGNFLNVV 75 DGL+ + + +VLM+ +M+ EAL +TL + + T++SR++ LW KGETSG+ V Sbjct: 19 DGLVAAVTVDHHTSDVLMMAWMDDEALHRTLVTRRATYYSRSRGELWVKGETSGHTQTVR 78 Query: 76 SIAPDCDNDTLLVLANPIGPTCHKGTSSCF 105 + DCD DT+LV GP CH G +CF Sbjct: 79 EVRVDCDGDTVLVRVEQTGPACHTGERTCF 108 Lambda K H 0.317 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 78 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 203 Length of database: 121 Length adjustment: 17 Effective length of query: 186 Effective length of database: 104 Effective search space: 19344 Effective search space used: 19344 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory