Align Anthranilate synthase component 1; AS; ASI; EC 4.1.3.27 (characterized)
to candidate WP_089300784.1 CHB84_RS07580 anthranilate synthase component I
Query= SwissProt::P20579 (493 letters) >NCBI__GCF_900188115.1:WP_089300784.1 Length = 546 Score = 382 bits (981), Expect = e-110 Identities = 227/507 (44%), Positives = 306/507 (60%), Gaps = 26/507 (5%) Query: 2 NREEFLRLAAVGYNRIPLACETLADFDTPLSIYLKLA-DQPNSYLLESVQGGEKWGRYSM 60 +REEF LA IP+ LAD +TP+ +Y KLA D+P ++L ES + GE W R+S Sbjct: 15 SREEFRALARER-RVIPVVRTVLADAETPIGLYRKLAADRPGTFLFESAEHGESWSRWSF 73 Query: 61 IGLPSRTVMRVHGYHVSIL-HDGVEVESHDVEDPLAFVESFKDRYKVADIPGLPRFNGGL 119 +G+ S + VH + L H V + S +PL+ + + +P +P GG+ Sbjct: 74 VGVRSPAALTVHDGEATWLGHPPVGLPSGG--NPLSALREAVEELHSEPLPDMPPLTGGM 131 Query: 120 VGYFGYDCVRYVEKRLGVSPNPDPLGVPDILLMVSDAVVVFDNLAGKMHAI---VLVDPA 176 VGY GYD VR++E+ D L +P+++++++ + +D+ G + I V D + Sbjct: 132 VGYIGYDAVRWLERL--PEHARDDLRIPELIMLLATDLAAYDHHEGTVTLIANAVNWDAS 189 Query: 177 EEQ---AFEQGQARLQGLLETLRQPITPRRGLDLSGPQAAEPEFRSSYTREDYENAVGRI 233 E+ A++ ARL + L QP TP P P+F T EDY +A+ R Sbjct: 190 PERVDAAYDDSVARLDEMSAALAQP-TPPTAATFDRPA---PQFHRRRTPEDYHDAIRRA 245 Query: 234 KEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMY------FFNFGD---FH 284 E + AG+ Q+VPSQR + A +D+YR LR NP+PYMY F + GD F Sbjct: 246 VEAVHAGEAFQIVPSQRFEMATGADALDVYRVLRTSNPSPYMYLLRLDGFDSNGDQIAFD 305 Query: 285 VVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLIDLGR 344 +VGSSPE LV V D T PIAGTR R + D L DLL+DDKE AEHLML+DLGR Sbjct: 306 IVGSSPESLVTVRDGRATTHPIAGTRWRAEDPDEDAMLAKDLLADDKERAEHLMLVDLGR 365 Query: 345 NDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVAGQLREGLTAMDALRAILPAGTLSGAP 404 ND+GRV G+V + + IERYS+VMHIVS V G+L G TA+DA+ A PAGTL+GAP Sbjct: 366 NDLGRVCKPGTVHVVDSFSIERYSHVMHIVSTVTGELDAGATAVDAVAACFPAGTLTGAP 425 Query: 405 KIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVINDGELHVQAGGGIVADS 464 K+RAME+IDELEP +RG+YGG VGY + G+ DTAIAIRTA++ DG +VQAGGG+VADS Sbjct: 426 KVRAMELIDELEPTRRGLYGGVVGYLDFAGDADTAIAIRTALMRDGVAYVQAGGGVVADS 485 Query: 465 VPALEWEETINKRRAMFRAVALAEQTS 491 P E E++NK R + AVA AE S Sbjct: 486 SPEYEDNESLNKARTVLAAVAAAETMS 512 Lambda K H 0.320 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 766 Number of extensions: 39 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 493 Length of database: 546 Length adjustment: 35 Effective length of query: 458 Effective length of database: 511 Effective search space: 234038 Effective search space used: 234038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_089300784.1 CHB84_RS07580 (anthranilate synthase component I)
to HMM TIGR00564 (trpE: anthranilate synthase component I (EC 4.1.3.27))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00564.hmm # target sequence database: /tmp/gapView.12012.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00564 [M=455] Accession: TIGR00564 Description: trpE_most: anthranilate synthase component I Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-169 549.4 0.0 4.4e-169 549.2 0.0 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089300784.1 CHB84_RS07580 anthranilate synth Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089300784.1 CHB84_RS07580 anthranilate synthase component I # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 549.2 0.0 4.4e-169 4.4e-169 1 453 [. 37 504 .. 37 506 .. 0.96 Alignments for each domain: == domain 1 score: 549.2 bits; conditional E-value: 4.4e-169 TIGR00564 1 adtltpisvylklak.rkesfllEsvekeeelgRySliglnpvleikakdgkavlleaddeeakieede 68 ad++tpi +y+kla r+ +fl+Es+e++e+++R+S++g+++ + ++++dg+a++l + +++ lcl|NCBI__GCF_900188115.1:WP_089300784.1 37 ADAETPIGLYRKLAAdRPGTFLFESAEHGESWSRWSFVGVRSPAALTVHDGEATWLGHPPVGLPSGGNP 105 599************88***************************************9777777799*** PP TIGR00564 69 lkelrkllekaeesedeld..eplsggavGylgydtvrlveklkeeaedelelpdlllllvetvivfDh 135 l++lr+ +e+++ ++ l+ +pl+gg+vGy+gyd vr +e+l+e+a+d+l++p+l++ll ++++++Dh lcl|NCBI__GCF_900188115.1:WP_089300784.1 106 LSALREAVEELH--SEPLPdmPPLTGGMVGYIGYDAVRWLERLPEHARDDLRIPELIMLLATDLAAYDH 172 **********64..445665689********************************************** PP TIGR00564 136 vekkvilienarteaers......aeeeaaarleellaelqkelekavkaleekkesftsnvekeeyee 198 e +v+li+na + + s a+++ arl+e+ a l +++ +++ + + + +f+ + + e+y++ lcl|NCBI__GCF_900188115.1:WP_089300784.1 173 HEGTVTLIANAVNWD-ASpervdaAYDDSVARLDEMSAALAQPTPPTAATFDRPAPQFHRRRTPEDYHD 240 *********996654.4446888999*******************999999999999************ PP TIGR00564 199 kvakakeyikaGdifqvvlSqrleakveakpfelYrkLRtvNPSpylyyldled.........felvgs 258 ++++a e+++aG+ fq+v+Sqr+e+ + a+++++Yr+LRt+NPSpy+y l l++ f +vgs lcl|NCBI__GCF_900188115.1:WP_089300784.1 241 AIRRAVEAVHAGEAFQIVPSQRFEMATGADALDVYRVLRTSNPSPYMYLLRLDGfdsngdqiaFDIVGS 309 *****************************************************9999999*99****** PP TIGR00564 259 SPEllvkvkgkrvetrPiAGtrkRGatkeeDealeeeLladeKerAEHlmLvDLaRNDigkvaklgsve 327 SPE+lv+v++ r +t+PiAGtr R ++++eD++l+++Llad KerAEHlmLvDL+RND+g+v+k+g+v+ lcl|NCBI__GCF_900188115.1:WP_089300784.1 310 SPESLVTVRDGRATTHPIAGTRWRAEDPDEDAMLAKDLLADDKERAEHLMLVDLGRNDLGRVCKPGTVH 378 ********************************************************************* PP TIGR00564 328 vkellkiekyshvmHivSeVeGelkdeltavDalraalPaGTlsGAPKvrAmelidelEkekRgiYgGa 396 v ++++ie+yshvmHivS+V+Gel ++tavDa+ a++PaGTl+GAPKvrAmelidelE+++Rg+YgG+ lcl|NCBI__GCF_900188115.1:WP_089300784.1 379 VVDSFSIERYSHVMHIVSTVTGELDAGATAVDAVAACFPAGTLTGAPKVRAMELIDELEPTRRGLYGGV 447 ********************************************************************* PP TIGR00564 397 vgylsfdgdvdtaiaiRtmvlkdgvayvqAgaGiVaDSdpeaEyeEtlnKakallra 453 vgyl+f+gd dtaiaiRt++++dgvayvqAg+G+VaDS+pe E +E+lnKa+++l a lcl|NCBI__GCF_900188115.1:WP_089300784.1 448 VGYLDFAGDADTAIAIRTALMRDGVAYVQAGGGVVADSSPEYEDNESLNKARTVLAA 504 ****************************************************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (455 nodes) Target sequences: 1 (546 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory