Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate WP_089301240.1 CHB84_RS09195 carbamoyl-phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >NCBI__GCF_900188115.1:WP_089301240.1 Length = 364 Score = 303 bits (777), Expect = 4e-87 Identities = 164/375 (43%), Positives = 217/375 (57%), Gaps = 21/375 (5%) Query: 8 VLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVGTND 67 +LEDG+ F G GA G A GEVVF T MTGYQE LTDPSY +QIV T P IGN G ND Sbjct: 1 MLEDGSVFRGLRYGAAGRAFGEVVFCTGMTGYQETLTDPSYHKQIVVQTAPQIGNTGWND 60 Query: 68 ADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGA 127 D+ESS++ G +RD + SN+R+ L + L+R +V IA +DTR LTR +RE GA Sbjct: 61 EDDESSRIWVAGYAVRDPARVPSNWRSARSLETELERQGVVGIAQLDTRTLTRHIREHGA 120 Query: 128 QNGCIIAGDNPDAA-LALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEAKK 186 + +G A L + P + G DLA EVTTAE Y + Sbjct: 121 MRAGVFSGTEVGTAEQMLARVTESPSMTGADLAGEVTTAEPY--------------VVRP 166 Query: 187 EDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPA 246 + + + V A D G K N RM+ RG + ++PA S ++VL + P G+FLSNGPGDPA Sbjct: 167 DGPVRYRVAAVDMGIKSNTPRMMAQRGIEVHVLPATASLDEVLAVEPHGVFLSNGPGDPA 226 Query: 247 PCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNVVM 306 + + L+ +P+FGIC G+Q+L A G T KM++GH G N PV D + Sbjct: 227 TTTHVTELTRNVLQRQVPLFGICFGNQILGRALGLGTYKMRYGHRGMNIPVMDTATRRIA 286 Query: 307 ITAQNHGFAVDE------ATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGP 360 ITAQNHGFA++ ++ ++H DGT++G+ D PAFS Q HPEA+ GP Sbjct: 287 ITAQNHGFALEGEPGARFSSPYGAATISHHCPNDGTVEGVRCLDVPAFSVQYHPEAAAGP 346 Query: 361 HDAAPLFDHFIELIE 375 HDAA LFD F+ L+E Sbjct: 347 HDAAVLFDEFVSLME 361 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 364 Length adjustment: 30 Effective length of query: 352 Effective length of database: 334 Effective search space: 117568 Effective search space used: 117568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_089301240.1 CHB84_RS09195 (carbamoyl-phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.21554.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-135 437.3 0.0 2.2e-135 437.2 0.0 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089301240.1 CHB84_RS09195 carbamoyl-phosphat Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089301240.1 CHB84_RS09195 carbamoyl-phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.2 0.0 2.2e-135 2.2e-135 4 360 .. 1 361 [. 1 362 [. 0.96 Alignments for each domain: == domain 1 score: 437.2 bits; conditional E-value: 2.2e-135 TIGR01368 4 vledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkik 72 +ledG+vf+g +ga + ++GevvF+T+mtGYqE+ltDpsY++qivv t+p+ign+g+n+ed es++i+ lcl|NCBI__GCF_900188115.1:WP_089301240.1 1 MLEDGSVFRGLRYGAAGRAFGEVVFCTGMTGYQETLTDPSYHKQIVVQTAPQIGNTGWNDEDDESSRIW 69 59******************************************************************* PP TIGR01368 73 vkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse..keelv 139 v+g v++ ++ +sn+r+ +sLe+ l+++g+v+i+++DTR+l++++Re+g+m+a + + ++ +e+ lcl|NCBI__GCF_900188115.1:WP_089301240.1 70 VAGYAVRDPARVPSNWRSARSLETELERQGVVGIAQLDTRTLTRHIREHGAMRAGVFSGTEVgtAEQML 138 ******************************************************999877545589999 PP TIGR01368 140 ekakespkvkevnlvkevstkeayeleqkakkegkk.lrvvvidlGvKenilreLvkrgvevtvvpadt 207 ++++esp++++++l+ ev+t+e+y ++ +g +rv+++d+G+K+n+ r++++rg+ev+v+pa++ lcl|NCBI__GCF_900188115.1:WP_089301240.1 139 ARVTESPSMTGADLAGEVTTAEPYVVRP----DGPVrYRVAAVDMGIKSNTPRMMAQRGIEVHVLPATA 203 9***********************9996....455459******************************* PP TIGR01368 208 saeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrG 276 s++e+ +++p+g++lsnGPGdPa+ +++ e ++++l++++P+fGIc+G+q+l++alg tyk+++GhrG lcl|NCBI__GCF_900188115.1:WP_089301240.1 204 SLDEVLAVEPHGVFLSNGPGDPATTTHVTELTRNVLQRQVPLFGICFGNQILGRALGLGTYKMRYGHRG 272 ********************************************************************* PP TIGR01368 277 aNhpvkdlktgrveitsqNHgyavdees.....lkeeelevthvnlnDgtveglehkelpvfsvQyHPe 340 +N+pv+d++t r+ it+qNHg+a++ e + +++++ h++ nDgtveg++ ++p+fsvQyHPe lcl|NCBI__GCF_900188115.1:WP_089301240.1 273 MNIPVMDTATRRIAITAQNHGFALEGEPgarfsSPYGAATISHHCPNDGTVEGVRCLDVPAFSVQYHPE 341 ************************988544444678999****************************** PP TIGR01368 341 aspGphdteylFdefvelik 360 a++Gphd+++lFdefv+l++ lcl|NCBI__GCF_900188115.1:WP_089301240.1 342 AAAGPHDAAVLFDEFVSLME 361 ****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.36 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory