Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_089301521.1 CHB84_RS11310 phosphoserine transaminase
Query= BRENDA::P9WQ73 (376 letters) >NCBI__GCF_900188115.1:WP_089301521.1 Length = 375 Score = 515 bits (1327), Expect = e-151 Identities = 244/367 (66%), Positives = 295/367 (80%) Query: 9 LEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAEL 68 L +P IKP DGRFG GPSKVR EQL L + AA+ GTSHRQ PVK+LVGRVR+GL +L Sbjct: 7 LTLPDDIKPADGRFGCGPSKVRTEQLAHLASGGAAVMGTSHRQKPVKDLVGRVRTGLRDL 66 Query: 69 FSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIII 128 F+LPDGYEV+LGNGG TAFWDAAAFGL+ +R+ TYGEFS+KFA PF+ +PI++ Sbjct: 67 FNLPDGYEVLLGNGGTTAFWDAAAFGLVRERAQLFTYGEFSSKFAKVAEGAPFLSDPIVV 126 Query: 129 TSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDI 188 S+PG+APE P D++ WAHNETSTGVAV VRRP GS+ ALV IDATSGAGGLPV Sbjct: 127 ASEPGTAPEITYQPGADIVGWAHNETSTGVAVPVRRPAGSEGALVTIDATSGAGGLPVAA 186 Query: 189 AETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQ 248 + D YYFAPQK FA+DGGLW+A+ SPAA+ RIE I +GRWVP+FLSL A++NS KNQ Sbjct: 187 EDFDVYYFAPQKCFAADGGLWVALASPAAVERIEEIGNSGRWVPEFLSLTTALDNSRKNQ 246 Query: 249 TYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLR 308 TYNTPA+ TL LLA+QI+W++ GGL+W KRTA+S++RLY WA++ YT+P+V++P LR Sbjct: 247 TYNTPAVGTLLLLADQIEWMLEGGGLEWTTKRTAESARRLYEWAEKTSYTSPYVSEPELR 306 Query: 309 SQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTEC 368 S VVGT+DF DDVDA +A LRANGIVD EPYRKLGRNQLRV MFPA+EPDD+SAL + Sbjct: 307 SHVVGTVDFADDVDATQLAATLRANGIVDVEPYRKLGRNQLRVGMFPAIEPDDISALIQS 366 Query: 369 VDWVVER 375 VDW+VER Sbjct: 367 VDWIVER 373 Lambda K H 0.317 0.134 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 586 Number of extensions: 20 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 375 Length adjustment: 30 Effective length of query: 346 Effective length of database: 345 Effective search space: 119370 Effective search space used: 119370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate WP_089301521.1 CHB84_RS11310 (phosphoserine transaminase)
to HMM TIGR01366 (putative phosphoserine aminotransferase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01366.hmm # target sequence database: /tmp/gapView.10309.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01366 [M=361] Accession: TIGR01366 Description: serC_3: putative phosphoserine aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-190 619.1 0.1 1.5e-190 618.9 0.1 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089301521.1 CHB84_RS11310 phosphoserine tran Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089301521.1 CHB84_RS11310 phosphoserine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 618.9 0.1 1.5e-190 1.5e-190 1 360 [. 14 373 .. 14 374 .. 1.00 Alignments for each domain: == domain 1 score: 618.9 bits; conditional E-value: 1.5e-190 TIGR01366 1 kpadgrfgagpskvrleqlqalvataasllgtshrqaavknlvgkvreglaelfslpdgyevilgngga 69 kpadgrfg+gpskvr+eql l++++a+++gtshrq +vk+lvg+vr gl++lf+lpdgyev+lgngg+ lcl|NCBI__GCF_900188115.1:WP_089301521.1 14 KPADGRFGCGPSKVRTEQLAHLASGGAAVMGTSHRQKPVKDLVGRVRTGLRDLFNLPDGYEVLLGNGGT 82 7******************************************************************** PP TIGR01366 70 tafwdaatfgliekkslhlsfgefsskfakaaklapfldepeivtadpgsapeaqaeegvdvialahne 138 tafwdaa+fgl+ ++++ +++gefsskfak a+ apfl++p++v+++pg+ape ++g+d++++ahne lcl|NCBI__GCF_900188115.1:WP_089301521.1 83 TAFWDAAAFGLVRERAQLFTYGEFSSKFAKVAEGAPFLSDPIVVASEPGTAPEITYQPGADIVGWAHNE 151 ********************************************************************* PP TIGR01366 139 tstgvavavrrpegsdealvvidatsgagglpvdiketdvyyfapqksfasdgglwlavlspaalerie 207 tstgvav+vrrp+gs++alv idatsgagglpv ++ dvyyfapqk+fa+dgglw+a+ spaa+erie lcl|NCBI__GCF_900188115.1:WP_089301521.1 152 TSTGVAVPVRRPAGSEGALVTIDATSGAGGLPVAAEDFDVYYFAPQKCFAADGGLWVALASPAAVERIE 220 ********************************************************************* PP TIGR01366 208 kiaasgrfvpeflslptavdnslknqtyntpavatlllldeqvdwlngnggldfavartkdsssrlysw 276 +i sgr+vpeflsl ta+dns+knqtyntpav tllll++q++w+ ggl+++++rt++s++rly+w lcl|NCBI__GCF_900188115.1:WP_089301521.1 221 EIGNSGRWVPEFLSLTTALDNSRKNQTYNTPAVGTLLLLADQIEWMLEGGGLEWTTKRTAESARRLYEW 289 ********************************************************************* PP TIGR01366 277 aeereyatpfvadaakrsqvvgtidfsddidaavvakilrangivdtepyrklgrnqlrvamfpaidpa 345 ae++ y++p+v+++ +rs+vvgt+df+dd+da+ +a lrangivd epyrklgrnqlrv+mfpai+p+ lcl|NCBI__GCF_900188115.1:WP_089301521.1 290 AEKTSYTSPYVSEPELRSHVVGTVDFADDVDATQLAATLRANGIVDVEPYRKLGRNQLRVGMFPAIEPD 358 ********************************************************************* PP TIGR01366 346 dvealteavdfvvek 360 d++al ++vd++ve+ lcl|NCBI__GCF_900188115.1:WP_089301521.1 359 DISALIQSVDWIVER 373 *************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (375 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.11 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory