Align ornithine carbamoyltransferase (EC 2.1.3.3) (characterized)
to candidate WP_089303058.1 CHB84_RS19230 ornithine carbamoyltransferase
Query= BRENDA::P0A5M9 (307 letters) >NCBI__GCF_900188115.1:WP_089303058.1 Length = 307 Score = 428 bits (1101), Expect = e-125 Identities = 219/307 (71%), Positives = 246/307 (80%), Gaps = 1/307 (0%) Query: 1 MIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNSTRTRFSFELG 60 M RHFLRDDDL PAEQ VL+LA +LK DP+ L GPR VAVIF+KNSTRTRFSFE G Sbjct: 1 MPRHFLRDDDLDPAEQNAVLDLADQLKADPLGSDALSGPRLVAVIFEKNSTRTRFSFEAG 60 Query: 61 IAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVWRTFGQERLDAMASVATVPVI 120 +AQLGGHA+VVD + QLGR+ETL+DTA+VLS Y DA+VWRTF Q R+D+ A V+ VPVI Sbjct: 61 VAQLGGHAMVVDGRAMQLGREETLEDTARVLSGYADAVVWRTFAQARMDSFAGVSRVPVI 120 Query: 121 NALSDEFHPCQVLADLQTIAERKGALRGLRLSYFGDGANNMAHSLLLGGVTAGIHVTVAA 180 NAL+DEFHPCQVLADLQTI +RKG L GL L+Y GDGANNMAHSLLLGGVTAG+HV +AA Sbjct: 121 NALTDEFHPCQVLADLQTIRQRKGTLAGLTLTYLGDGANNMAHSLLLGGVTAGLHVRIAA 180 Query: 181 PEGFLPDPSVRAAAERRAQDTGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVK 240 PEGF P P V RRA +TG SV V +D A GADVL TD+WTSMGQE DG DRV Sbjct: 181 PEGFHPMPWVLDLVRRRAAETGGSVGVFSDPVEAVDGADVLATDSWTSMGQETDGKDRVG 240 Query: 241 PFRPFQLNSRLLA-LADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKAL 299 PFRPFQ++++LL D IVLH LPAHRG EITD V+DGPASAVWDEAENRLHAQKAL Sbjct: 241 PFRPFQVSTQLLGRTGKDDTIVLHDLPAHRGWEITDEVIDGPASAVWDEAENRLHAQKAL 300 Query: 300 LVWLLER 306 LVWLL R Sbjct: 301 LVWLLGR 307 Lambda K H 0.319 0.133 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_089303058.1 CHB84_RS19230 (ornithine carbamoyltransferase)
to HMM TIGR00658 (argF: ornithine carbamoyltransferase (EC 2.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00658.hmm # target sequence database: /tmp/gapView.14748.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00658 [M=304] Accession: TIGR00658 Description: orni_carb_tr: ornithine carbamoyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-110 354.6 0.0 2.3e-110 354.5 0.0 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089303058.1 CHB84_RS19230 ornithine carbamoy Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089303058.1 CHB84_RS19230 ornithine carbamoyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 354.5 0.0 2.3e-110 2.3e-110 1 303 [. 3 305 .. 3 306 .. 0.98 Alignments for each domain: == domain 1 score: 354.5 bits; conditional E-value: 2.3e-110 TIGR00658 1 rhllslldlseeelkellelakklkkekkkgkeekklkg.ktlaliFekrstRtRvsfevaayelGaqv 68 rh+l dl+++e + +l+la++lk++ ++ l+g + +a+iFek+stRtR sfe+++++lG+++ lcl|NCBI__GCF_900188115.1:WP_089303058.1 3 RHFLRDDDLDPAEQNAVLDLADQLKADPLG---SDALSGpRLVAVIFEKNSTRTRFSFEAGVAQLGGHA 68 799999********************9988...5678774789************************** PP TIGR00658 69 lylnkeelqlgrkesikDtarvlsryvdaivvRvykhedveelakyasvPvingLtdlehPcqilaDll 137 ++++ +qlgr+e+++Dtarvls y da+v R++++ + ++a + vPvin+Ltd++hPcq+laDl+ lcl|NCBI__GCF_900188115.1:WP_089303058.1 69 MVVDGRAMQLGREETLEDTARVLSGYADAVVWRTFAQARMDSFAGVSRVPVINALTDEFHPCQVLADLQ 137 ********************************************************************* PP TIGR00658 138 tikeklgklkevklvyvGDa.nnvanslllaaaklGldvvvatPeglepeaeivkkakkiakenggkle 205 ti+ ++g+l +++l+y+GD+ nn+a+slll++++ Gl+v++a+Peg++p + +++ ++ a+e+gg++ lcl|NCBI__GCF_900188115.1:WP_089303058.1 138 TIRQRKGTLAGLTLTYLGDGaNNMAHSLLLGGVTAGLHVRIAAPEGFHPMPWVLDLVRRRAAETGGSVG 206 ********************9************************************************ PP TIGR00658 206 ltedpkkavkdadviytDvwvsmGeeekkeerlkllkpyqvneellela.kpevkflhCLPavrGeevt 273 + +dp++av +adv+ tD w+smG+e++ ++r+ ++p+qv+++ll + k+++++lh LPa+rG e+t lcl|NCBI__GCF_900188115.1:WP_089303058.1 207 VFSDPVEAVDGADVLATDSWTSMGQETDGKDRVGPFRPFQVSTQLLGRTgKDDTIVLHDLPAHRGWEIT 275 ***********************************************999******************* PP TIGR00658 274 devlegeasivfdeaenRlhaqkavlkall 303 dev++g+as v+deaenRlhaqka+l++ll lcl|NCBI__GCF_900188115.1:WP_089303058.1 276 DEVIDGPASAVWDEAENRLHAQKALLVWLL 305 ***************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 11.33 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory