Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_089322408.1 CHB58_RS01855 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_900188395.1:WP_089322408.1 Length = 441 Score = 246 bits (629), Expect = 1e-69 Identities = 158/405 (39%), Positives = 232/405 (57%), Gaps = 16/405 (3%) Query: 391 IIENVRDKGNSALLEYTEKFDGVKLS--NPVLNAPFPEEYFEGLTEEMKEALDLSIENVR 448 IIENVR G++A+ Y +KFD V L+ N ++ EE F+ + E EA+ L++E V+ Sbjct: 38 IIENVRKYGDTAVFGYAKKFDRVDLTPENVKVSEIEIEETFKKVEPEAVEAIKLAVERVK 97 Query: 449 KFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGVPAQVAQCK 508 +FH Q E T+ G++ + P++ G+Y+PGG A PS+ +M VPA+VA K Sbjct: 98 RFHEHQ--KENSYFVTEDGMVLGQKVTPLDSAGIYVPGGKASYPSSVIMNAVPAKVAGVK 155 Query: 509 EIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPKVDKILGPG 568 +++ +P S KV+P + A+ G +I GGA VAA+A+GT +IPKVDKI+GPG Sbjct: 156 KVIMVTPAIGSL-KVNPYSLVAAKLSGVDEIYRVGGAHGVAAIAFGTASIPKVDKIVGPG 214 Query: 569 NQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAEHGIDSQVI 628 N +V AK ++ IDM AGPSE+L+IADE A+ ++VA DLLSQAEH + Sbjct: 215 NIYVALAKKFLFGQVD----IDMVAGPSEILIIADETANPEWVAVDLLSQAEHDELAGSF 270 Query: 629 LVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCIAH-STIVLCDGYEEALEMSNQYAPE 687 LV EK E + V+ +L R +I +K I + T+ L + + + E++N APE Sbjct: 271 LV--THDEKTAFETVEKVNELLKKLKRKEIAKKSIENFGTVFLTENVKHSCEVANVIAPE 328 Query: 688 HLILQIANANDYVKL--VDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGANTA 745 HL ++A + L + NAG++F+G YT ES GDY G NH LPT G A+ +S Sbjct: 329 HL--EVATKEPFALLDNIKNAGAIFLGHYTCESLGDYLLGPNHVLPTGGSAKFFSPLGVY 386 Query: 746 TFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRMSK 790 F K + ++ EG E + +A EGL+ H A +IR K Sbjct: 387 DFIKRSSILYVSKEGFEKVSSFTALLADIEGLEAHGLAARIRDEK 431 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 805 Number of extensions: 44 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 441 Length adjustment: 37 Effective length of query: 762 Effective length of database: 404 Effective search space: 307848 Effective search space used: 307848 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory