Align Histidinol-phosphatase; HolPase; EC 3.1.3.15; Histidinol-phosphate phosphatase (uncharacterized)
to candidate WP_089322437.1 CHB58_RS02010 inositol monophosphatase
Query= curated2:P56160 (259 letters) >NCBI__GCF_900188395.1:WP_089322437.1 Length = 261 Score = 120 bits (302), Expect = 2e-32 Identities = 80/252 (31%), Positives = 129/252 (51%), Gaps = 6/252 (2%) Query: 5 LQLALELAEKAGKLTLDYFGR-RSLQVFSKRDDTPVTEADRNAEELIRQGISAKFPDDGL 63 + +A++ AE+A ++ Y +S +V K + VT+AD AE+ I + I A FPD + Sbjct: 4 VDVAVKAAERASEILKKYHNELKSFEVELKAKNDYVTKADTEAEKAIIEEIKAYFPDHSI 63 Query: 64 FGEEFDEHPSGNGRRWIIDPIDGTRSFIHGVPLYGVMIALEVEGAMQLGVINFPALGELY 123 EE +GN RW IDP+DGT++FIHG+P + V I + + + GVI P E++ Sbjct: 64 VAEESGIF-TGNSYRWFIDPLDGTKNFIHGLPFFCVSIGVMYKDELVAGVIKIPFFDEIF 122 Query: 124 QAERGSGAFMNGSPVQVSAIAENS---ASTVVFTEKEYLLDPPSNHPVDQLRIDAGLVRG 180 AE+G G F NG V+VS + N A+ F K+ L D L + +G+ R Sbjct: 123 TAEKGCGTFRNGEKVKVSERSFNEGLFATGFPFRGKDMLDDYLPCFKEVFLNV-SGIRRC 181 Query: 181 WGDCYGHMLVASGRAEVAVDKIMSPWDCAAVIPIVEEAGGCCFDYRGRQSIIDGEGLVSA 240 A G + + + PWD AA + ++EEAGG D++G + ++ ++ A Sbjct: 182 GAAAIDLAYTACGIFDGFWELSLKPWDIAAGVLMIEEAGGIVSDFKGGKEYLESGNIIGA 241 Query: 241 NNAMGRNLIAAI 252 + + L A + Sbjct: 242 SAKSYQQLFAIV 253 Lambda K H 0.319 0.138 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 261 Length adjustment: 24 Effective length of query: 235 Effective length of database: 237 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory