Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_089322761.1 CHB58_RS03675 pyridoxal phosphate-dependent aminotransferase
Query= metacyc::MONOMER-21143 (387 letters) >NCBI__GCF_900188395.1:WP_089322761.1 Length = 396 Score = 241 bits (615), Expect = 3e-68 Identities = 133/387 (34%), Positives = 224/387 (57%), Gaps = 9/387 (2%) Query: 3 LAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHHG 62 L+ ++ + ++ ++AK++ A+G +I G G+PDF TP HV +AA KA++EG Sbjct: 4 LSHRVRNMAPSPTMAITSKAKEMRAKGIDVIGFGAGEPDFDTPSHVKEAAIKAIEEGFTK 63 Query: 63 YVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPTP 122 Y + GI E R+ + +K+ + + ++++ G K ++ + + G E+I P P Sbjct: 64 YTPAAGIPELREVIAQKLLRENGIEYSSSQIVVTDGAKFALFSLMLSVIDEGDEVIIPAP 123 Query: 123 AFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVEK 182 + Y + + G PV + +E+ F E + ++T++T+LLIL +P+NPTG+ + + Sbjct: 124 YWVTYPEQVKFAGGKPVFVNTSEENGFIFTLELLEKVVTERTKLLILCSPSNPTGAVIPE 183 Query: 183 SAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPD-LQDRLIVLDGWSKAYAM 241 + + E + I SDE Y + +Y+G++ + + D L++ I ++ SKAY+M Sbjct: 184 DELKRIGE-FCAEKGILIASDECYEKLVYEGEKHVSIASISDELKEITITINALSKAYSM 242 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G++ P E+I + K+ SVS VN+ +Q A +AAL GP + + + + FD+RR+ Sbjct: 243 TGWRVGYAAGPSEIISSMIKINSQSVSNVNSIAQKAAVAALTGPQEFLKDWLKAFDERRR 302 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFP---KVIGTG--MNGSEFAKKCMHEAGVAIVPGTAF 356 + E NS+PGV C++P GAFYAFP KV+ G + EFA + A VA VPG+AF Sbjct: 303 YMVERFNSIPGVSCTVPKGAFYAFPNIKKVLERGGFKDDFEFADFLIENAKVAAVPGSAF 362 Query: 357 GKTCQDYVRFSYAASQDNISNALENIK 383 G Y+RFSYA S +NI L+ + Sbjct: 363 G--YPGYMRFSYATSMENIKKGLDRFE 387 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 396 Length adjustment: 31 Effective length of query: 356 Effective length of database: 365 Effective search space: 129940 Effective search space used: 129940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory