Align aspartate transaminase (EC 2.6.1.1) (characterized)
to candidate WP_089322761.1 CHB58_RS03675 pyridoxal phosphate-dependent aminotransferase
Query= BRENDA::A0A6F8T0V6 (393 letters) >NCBI__GCF_900188395.1:WP_089322761.1 Length = 396 Score = 423 bits (1087), Expect = e-123 Identities = 210/392 (53%), Positives = 277/392 (70%), Gaps = 4/392 (1%) Query: 3 LAKRVASLTPSATLAITAKAKELKAAGYDVIGLGAGEPDFNTPQHIIAAAIKTMNEGHTK 62 L+ RV ++ PS T+AIT+KAKE++A G DVIG GAGEPDF+TP H+ AAIK + EG TK Sbjct: 4 LSHRVRNMAPSPTMAITSKAKEMRAKGIDVIGFGAGEPDFDTPSHVKEAAIKAIEEGFTK 63 Query: 63 YTPSGGLPALKEEIIKKFARDQGLSYEPAEIIVCVGAKHALYTLFQVLLDEGDEVIIPTP 122 YTP+ G+P L+E I +K R+ G+ Y ++I+V GAK AL++L ++DEGDEVIIP P Sbjct: 64 YTPAAGIPELREVIAQKLLRENGIEYSSSQIVVTDGAKFALFSLMLSVIDEGDEVIIPAP 123 Query: 123 YWVSYPEQVKLAGGVPVYVEGLEENDFKMTPDQLKQAITPKTKAVIINSPSNPTGMIYTA 182 YWV+YPEQVK AGG PV+V EEN F T + L++ +T +TK +I+ SPSNPTG + Sbjct: 124 YWVTYPEQVKFAGGKPVFVNTSEENGFIFTLELLEKVVTERTKLLILCSPSNPTGAVIPE 183 Query: 183 EELKALGEVCLAHGVLIVSDEIYEKLIYGGAKHVSIAELSPELKEQTIIINGVSKSHSMT 242 +ELK +GE C G+LI SDE YEKL+Y G KHVSIA +S ELKE TI IN +SK++SMT Sbjct: 184 DELKRIGEFCAEKGILIASDECYEKLVYEGEKHVSIASISDELKEITITINALSKAYSMT 243 Query: 243 GWRIGYAAGPKDIIQAMTDLASHSTSNPTSIAQYAAIAAYSGPQEPVEQMRQAFEERLNI 302 GWR+GYAAGP +II +M + S S SN SIAQ AA+AA +GPQE ++ +AF+ER Sbjct: 244 GWRVGYAAGPSEIISSMIKINSQSVSNVNSIAQKAAVAALTGPQEFLKDWLKAFDERRRY 303 Query: 303 IYDKLVQIPGFTCIKPQGAFYLFPNARKAADMAGCRTVDEFVAALLEEAKVALVPGSGFG 362 + ++ IPG +C P+GAFY FPN +K + G + EF L+E AKVA VPGS FG Sbjct: 304 MVERFNSIPGVSCTVPKGAFYAFPNIKKVLERGGFKDDFEFADFLIENAKVAAVPGSAFG 363 Query: 363 APDYVRLSYATSLEALETAIER----IRRFME 390 P Y+R SYATS+E ++ ++R +R ME Sbjct: 364 YPGYMRFSYATSMENIKKGLDRFEAAVRLIME 395 Lambda K H 0.316 0.133 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 396 Length adjustment: 31 Effective length of query: 362 Effective length of database: 365 Effective search space: 132130 Effective search space used: 132130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory