Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate WP_089323032.1 CHB58_RS05105 imidazole glycerol phosphate synthase subunit HisF
Query= SwissProt::Q7SIB9 (252 letters) >NCBI__GCF_900188395.1:WP_089323032.1 Length = 251 Score = 331 bits (849), Expect = 8e-96 Identities = 169/250 (67%), Positives = 206/250 (82%), Gaps = 1/250 (0%) Query: 3 LAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAI 62 LAKRI+PCLDV GRVVKGVNFVNL DAGDPVE A+ YDE GADELVFLDI+A++E+R I Sbjct: 2 LAKRIIPCLDVKEGRVVKGVNFVNLIDAGDPVENAKVYDEQGADELVFLDITASYEKRGI 61 Query: 63 LLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFG 122 ++DVV R AE VF+PLTVGGG+R++ED R LL +GADKVS+N+AAV+ PEL++E A FG Sbjct: 62 MIDVVRRTAETVFMPLTVGGGIRTVEDIRNLLNAGADKVSINTAAVKNPELVKEGARIFG 121 Query: 123 AQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEG 182 +Q +V+AIDA+ +G+ E+++ GGR PTG+ AVEWA K V+LGAGEILLTSMDRDGTK+G Sbjct: 122 SQCIVVAIDAKRKGNSWEIYIHGGRTPTGIDAVEWAKKVVDLGAGEILLTSMDRDGTKQG 181 Query: 183 YDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQAG-AEAALAASVFHFGEIPIPKLKRY 241 YD+ LTR ++EAV VPVIASGGAG EHF E G A+A LAASVFHF EI I +LK + Sbjct: 182 YDVELTRAISEAVSVPVIASGGAGTKEHFYEGLVYGKADAVLAASVFHFKEITIGELKEF 241 Query: 242 LAEKGVHVRL 251 L KGV+VRL Sbjct: 242 LKVKGVNVRL 251 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 251 Length adjustment: 24 Effective length of query: 228 Effective length of database: 227 Effective search space: 51756 Effective search space used: 51756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate WP_089323032.1 CHB58_RS05105 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.10889.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-126 404.8 3.5 7.2e-126 404.6 3.5 1.0 1 lcl|NCBI__GCF_900188395.1:WP_089323032.1 CHB58_RS05105 imidazole glycerol Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188395.1:WP_089323032.1 CHB58_RS05105 imidazole glycerol phosphate synthase subunit HisF # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 404.6 3.5 7.2e-126 7.2e-126 1 254 [] 1 250 [. 1 250 [. 0.99 Alignments for each domain: == domain 1 score: 404.6 bits; conditional E-value: 7.2e-126 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevverv 69 mlakriipCLdvk+grvvkGv+f nl daGdpve ak+yde+Gadelvflditas ekr +m++vv+r+ lcl|NCBI__GCF_900188395.1:WP_089323032.1 1 MLAKRIIPCLDVKEGRVVKGVNFVNLIDAGDPVENAKVYDEQGADELVFLDITASYEKRGIMIDVVRRT 69 8******************************************************************** PP TIGR00735 70 aekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaene 138 ae+vf+PltvgGGi+++ed+++ll+aGadkvsintaavk+pel+ke a++fGsq+ivvaidakr+ + lcl|NCBI__GCF_900188395.1:WP_089323032.1 70 AETVFMPLTVGGGIRTVEDIRNLLNAGADKVSINTAAVKNPELVKEGARIFGSQCIVVAIDAKRKGN-- 136 ****************************************************************996.. PP TIGR00735 139 eakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgG 207 ++e++i+gGr+ t++d+vewak+v +lGaGeilltsmd+dGtk+Gyd+el+++++eav++PviasgG lcl|NCBI__GCF_900188395.1:WP_089323032.1 137 --SWEIYIHGGRTPTGIDAVEWAKKVVDLGAGEILLTSMDRDGTKQGYDVELTRAISEAVSVPVIASGG 203 ..5****************************************************************** PP TIGR00735 208 aGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254 aG++eh++e+++ gkada+Laasvfh++e+ti+e+ke+l+ +gv+vr lcl|NCBI__GCF_900188395.1:WP_089323032.1 204 AGTKEHFYEGLVYGKADAVLAASVFHFKEITIGELKEFLKVKGVNVR 250 **********************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (251 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.88 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory