Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_089323045.1 CHB58_RS05155 triose-phosphate isomerase
Query= BRENDA::P00943 (253 letters) >NCBI__GCF_900188395.1:WP_089323045.1 Length = 253 Score = 246 bits (627), Expect = 4e-70 Identities = 121/251 (48%), Positives = 177/251 (70%), Gaps = 2/251 (0%) Query: 1 MRKPIIAGNWKMHKTLAEAVQFVEDVKGHVPPADEVISVVCAPFLFLDRLVQAADGTDLK 60 +R+P+IAGNWKM+KT+ E+++F + V + ++ PF + + + G+++ Sbjct: 5 VRRPLIAGNWKMNKTVTESIEFAKGFIEAVKDVTDRDIMIAPPFTSIYPMAEVLKGSNVY 64 Query: 61 IGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAFTRG 120 +GAQ M+F ++GA+TGEVSP+MLKD G +VILGHSERR +F ETDE +NKKVL+A + Sbjct: 65 LGAQNMYFEEKGAFTGEVSPIMLKDAGCKFVILGHSERRYIFGETDELINKKVLSAVSHE 124 Query: 121 LIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQAVIAYEPIWAIGTGKSSTP 180 LIP++C GE LEERE G+T VV Q+ + L G+ PE + VIAYEP+WAIGTGK++TP Sbjct: 125 LIPVLCVGELLEERELGKTFEVVERQLSEGLKGV-PESA-EFVIAYEPVWAIGTGKTATP 182 Query: 181 EDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGASLEP 240 + A + +R ++ L+G A+++RI YGGSVKP+N+ +A + IDG LVGGASL+ Sbjct: 183 QLAEEIHSFLREKLTELYGKSKADSVRILYGGSVKPENVEGLMAMKNIDGALVGGASLKV 242 Query: 241 ASFLQLVEAGR 251 SF ++V+ GR Sbjct: 243 DSFEKIVKFGR 253 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 253 Length of database: 253 Length adjustment: 24 Effective length of query: 229 Effective length of database: 229 Effective search space: 52441 Effective search space used: 52441 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
Align candidate WP_089323045.1 CHB58_RS05155 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00419.hmm # target sequence database: /tmp/gapView.12018.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-61 192.2 0.0 6.5e-61 192.0 0.0 1.0 1 lcl|NCBI__GCF_900188395.1:WP_089323045.1 CHB58_RS05155 triose-phosphate i Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188395.1:WP_089323045.1 CHB58_RS05155 triose-phosphate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 192.0 0.0 6.5e-61 6.5e-61 1 228 [] 9 243 .. 9 243 .. 0.95 Alignments for each domain: == domain 1 score: 192.0 bits; conditional E-value: 6.5e-61 TIGR00419 1 lviinfKlnesvgkvelevaklaeevaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGa 68 l+ +n+K+n +v + + e v ++++ + +appf + +++ ++ s++ ++Aqn+ ++Ga lcl|NCBI__GCF_900188395.1:WP_089323045.1 9 LIAGNWKMNKTVTESIEFAKGFIEAVKDVTDRDIMIAPPFTSIYPMAEVLKgSNVYLGAQNMYFEEKGA 77 689**********************************************999***************** PP TIGR00419 69 ftGeisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinn 137 ftGe+s mlkd+G+k+v++gHsErR ++ e+deli+kkv + +l +v+Cvge leere ++t+++ lcl|NCBI__GCF_900188395.1:WP_089323045.1 78 FTGEVSPIMLKDAGCKFVILGHSERRYIFGETDELINKKVLSAVSHELIPVLCVGELLEERELGKTFEV 146 **************************99***************************************** PP TIGR00419 138 vattaaaaA.....lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkk.vskevaesvrvlyGas 200 v ++ + + v+A+EPv++iGtGk++++ ae++++++r+ l++ k a+svr+lyG+s lcl|NCBI__GCF_900188395.1:WP_089323045.1 147 VERQLSEGLkgvpeSAEFVIAYEPVWAIGTGKTATPQLAEEIHSFLREKLTElYGKSKADSVRILYGGS 215 *998543333444477889********************************9888999*********** PP TIGR00419 201 vtaaedaelaaqldvdGvLlasavlkae 228 v+ ++ l+a ++dG+L+++a+lk + lcl|NCBI__GCF_900188395.1:WP_089323045.1 216 VKPENVEGLMAMKNIDGALVGGASLKVD 243 *************************975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (253 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.77 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory