Align alanine-glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate WP_089323728.1 CHB58_RS08740 succinyldiaminopimelate transaminase
Query= BRENDA::D2Z0I0 (402 letters) >NCBI__GCF_900188395.1:WP_089323728.1 Length = 387 Score = 169 bits (427), Expect = 2e-46 Identities = 120/383 (31%), Positives = 195/383 (50%), Gaps = 20/383 (5%) Query: 10 VKKLPKYVFAMVNELKYQLRREGEDIVDLGMGNPDIPPSQHIIDKLCEVANRPNVHGYSA 69 ++ + Y + + K L+++G+ I D G G+P P + I + + P V Y Sbjct: 5 LRNMKPYPMDELVKAKELLKKDGKKIYDFGTGDPKEPTAPFIREAVKTAI--PEVSQYPT 62 Query: 70 SKGIPRLRKAICDFYKRRYGVELDPERNAIMTIGAKEGYSHLMLAMLEPGD---TVIVPN 126 KG LR+AI ++KRR+ VELD E+ I + G+KE H L ++ VI Sbjct: 63 VKGRKDLREAISSWFKRRFDVELDSEKEIIPSAGSKEAIFHFPLVFIDADSDKKRVIFGT 122 Query: 127 PTYPIHYYAPIICGGDAISVPILPEEDFPEVFLRRLYDLIKTSFRKPKAVVLSFPHNPTT 186 P YP++ + G +P + E FL RL + + ++ K V L++PHNPT Sbjct: 123 PAYPVYERGTLFAQG----IPTSYTLKYEEGFLLRLDKMPEEILKETKIVWLNYPHNPTG 178 Query: 187 LCVDLEFFQEVVKLAKQEGIWIVHDFAYADLGFDGYTPPSILQVEGALDVAVELYSMSKG 246 L +F+++ ++ ++ I + D Y ++ F+ PPS LQV G +V V +S+SK Sbjct: 179 ATAPLSYFEDMYQICREYDIIMCSDECYTEIYFE-EKPPSALQV-GKENVVV-FHSLSKR 235 Query: 247 FSMAGWRVAFVVGNEMLIKNLAHLKSYLDYGVFTP--IQVASIIALESPYEVVEKNREIY 304 M G+R FV G+ +I+ +S +GV +P IQV + A + VE+ R I+ Sbjct: 236 SGMTGYRSGFVAGDSRIIQEYLRFRS--SFGVGSPDFIQVGAREAWKDESH-VEERRLIF 292 Query: 305 RRRRDVLVEGLNRVGWEVKKPKGSMFVWAKVPEEVGMNSLDFSLFLLREAKVAVSPGIGF 364 R+++++ + G+E K S + W KVP G+ S D++ LL+ + VSPG F Sbjct: 293 RKKKEIFEKFFKEEGFEFLDVKASFYFWVKVP--FGLTSKDYAFHLLKYG-IVVSPGEFF 349 Query: 365 GEYGEGYVRFALVENEHRIRQAV 387 G GEG+ R ALV + +AV Sbjct: 350 GSGGEGFFRIALVPSVDECEEAV 372 Lambda K H 0.322 0.141 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 435 Number of extensions: 23 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 387 Length adjustment: 31 Effective length of query: 371 Effective length of database: 356 Effective search space: 132076 Effective search space used: 132076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory