Align succinyldiaminopimelate transaminase (EC 2.6.1.17); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_089323728.1 CHB58_RS08740 succinyldiaminopimelate transaminase
Query= BRENDA::Q82IK5 (364 letters) >NCBI__GCF_900188395.1:WP_089323728.1 Length = 387 Score = 173 bits (439), Expect = 6e-48 Identities = 121/379 (31%), Positives = 175/379 (46%), Gaps = 26/379 (6%) Query: 1 MSAVSDRLPTFPWDKLEPYKARAAAHPDG--IVDLSVGTPVDPVPELIQKAL-VAAADSP 57 M++V + +P D+L KA+ DG I D G P +P I++A+ A + Sbjct: 1 MNSVLRNMKPYPMDEL--VKAKELLKKDGKKIYDFGTGDPKEPTAPFIREAVKTAIPEVS 58 Query: 58 GYPTVWGTPELRDALTGWVERRLGARGVTHHHVLPIVGSKELVAWLPTQLGLGPGDK--V 115 YPTV G +LR+A++ W +RR + ++P GSKE + P DK V Sbjct: 59 QYPTVKGRKDLREAISSWFKRRFDVELDSEKEIIPSAGSKEAIFHFPLVFIDADSDKKRV 118 Query: 116 AHPRLAYPTYEVGARLARADHVVY------------DDPTELDPTGLKLLWLNSPSNPTG 163 AYP YE G A+ Y D E K++WLN P NPTG Sbjct: 119 IFGTPAYPVYERGTLFAQGIPTSYTLKYEEGFLLRLDKMPEEILKETKIVWLNYPHNPTG 178 Query: 164 KVLSKAELTRIVAWAREHGILVFSDECYLELGWEADPVSVLHPDVCGGSYEGIVSVHSLS 223 + + RE+ I++ SDECY E+ +E P S L E +V HSLS Sbjct: 179 ATAPLSYFEDMYQICREYDIIMCSDECYTEIYFEEKPPSALQV-----GKENVVVFHSLS 233 Query: 224 KRSNLAGYRAAFLAGDPAVLGPLLQIRKHGGMMTSAPTQAAVVAALGDDAHVREQRERYA 283 KRS + GYR+ F+AGD ++ L+ R G+ + Q A D++HV E+R + Sbjct: 234 KRSGMTGYRSGFVAGDSRIIQEYLRFRSSFGVGSPDFIQVGAREAWKDESHVEERRLIFR 293 Query: 284 ARRTALRDALLSHGFRIEHSEASLYLW--ATRGESCWDTVAHLADLGILVAPGDFYGSAG 341 ++ GF +AS Y W G + D HL GI+V+PG+F+GS G Sbjct: 294 KKKEIFEKFFKEEGFEFLDVKASFYFWVKVPFGLTSKDYAFHLLKYGIVVSPGEFFGSGG 353 Query: 342 EQFVRVALTATDERVAAAV 360 E F R+AL + + AV Sbjct: 354 EGFFRIALVPSVDECEEAV 372 Lambda K H 0.319 0.135 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 387 Length adjustment: 30 Effective length of query: 334 Effective length of database: 357 Effective search space: 119238 Effective search space used: 119238 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory