Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate WP_090440660.1 BLS63_RS05050 branched-chain amino acid transaminase
Query= BRENDA::P54691 (305 letters) >NCBI__GCF_900100495.1:WP_090440660.1 Length = 307 Score = 177 bits (448), Expect = 4e-49 Identities = 106/299 (35%), Positives = 164/299 (54%), Gaps = 13/299 (4%) Query: 7 IAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKS 66 + +++ K VP+ DA V TH LHYG F G+R P+ GT + FRL H DRL S Sbjct: 9 VIWYDGKLVPWRDATTHVLTHTLHYGMGVFEGVRAYDTPD--GTAI-FRLQAHTDRLFDS 65 Query: 67 AKFLHYDI--SAEKIKEVIVDFVKKNQPDKSFYIRPLVYSSGLGIAPRLHNLEKDFLV-- 122 A + I S ++I + V++N + S YIRP+V+ + R L+ +V Sbjct: 66 AHIMGMKIPFSKDEINQATRAAVRENNLE-SAYIRPMVFYGSEAMGLRATGLKVQVIVAA 124 Query: 123 --YGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAI 180 +G MGD G+ R SS+ R R K + YI S LA EA+ G DEA+ Sbjct: 125 WNWGAYMGDEALQVGIKVRTSSFTRHHVNISMTRAKANGNYINSMLALQEAISGGADEAM 184 Query: 181 LMNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDK 240 L++++G V E +G N+F+V+NG + TP L GITR+++L +A +LGI ++ I + Sbjct: 185 LLDTEGYVAEGSGENIFLVKNGVVYTP-EVTSCLNGITRNTVLQLADELGIKVVEKRITR 243 Query: 241 SELMIADEVFLSGTAAKITPVKRIENFTLGGDR--PITEKLRSVLTAVTENREPKYQDW 297 E+ IADE F +GTAA++TP++ ++ +G R P+TEKL+ + + + +W Sbjct: 244 DEVYIADEAFFTGTAAEVTPIREVDGRQIGAGRRGPVTEKLQKAYFDLVTGKSSAHAEW 302 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 228 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 307 Length adjustment: 27 Effective length of query: 278 Effective length of database: 280 Effective search space: 77840 Effective search space used: 77840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory