Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_090441304.1 BLS63_RS06060 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_900100495.1:WP_090441304.1 Length = 278 Score = 163 bits (413), Expect = 3e-45 Identities = 94/264 (35%), Positives = 145/264 (54%), Gaps = 11/264 (4%) Query: 11 LTDVIDRLLAPE-GCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVMFLL 69 L ++ RL P+ GCPWD +Q+ S+ Y +EE +E+ +AI G+ D + E+GD++F + Sbjct: 7 LLHLMARLRDPQHGCPWDLKQSYASIVPYTIEEAYEVADAIERGDFDHLPGELGDLLFQV 66 Query: 70 AFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSD-----TTYADRDE---FLRNWESI 121 + +L ++G F + K+IRRHPHVF D T A R E + WE + Sbjct: 67 VYYSQLAREEGRFEFAQVVDGITRKLIRRHPHVFVDGDLYGTPDAARLEEAAVKQRWEEL 126 Query: 122 KRAEKADAEGEPQ--GVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWL 179 K E+A+ P+ + D +PA+LP L +A ++ +AA+VGF WP V +V E Sbjct: 127 KAEERAEKAAAPEQLSLLDDVPAALPALSRAAKLQKRAAQVGFDWPAALPVVDKVREELD 186 Query: 180 ELLDVLAGDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARE 239 E+L+ ++ +D A E+GDL+F + L R ++ +AL N KF +RFR +E RE Sbjct: 187 EVLEAMSENDPQAMAEEIGDLLFVVTNLARHLKVEPESALRAANGKFEQRFRFIEQALRE 246 Query: 240 RGLDFPALSLDDKDELWNEAKAAE 263 G L++ D LW EAK E Sbjct: 247 AGRAMEDCDLEELDALWGEAKKLE 270 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 278 Length adjustment: 25 Effective length of query: 242 Effective length of database: 253 Effective search space: 61226 Effective search space used: 61226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory