Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_090443146.1 BLS63_RS09295 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >NCBI__GCF_900100495.1:WP_090443146.1 Length = 384 Score = 476 bits (1225), Expect = e-139 Identities = 241/375 (64%), Positives = 281/375 (74%), Gaps = 2/375 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS-PL 62 S L LA ELI R SVTP D GCQ+LM+ RL+ALGF IE M E+ NFWA G Q P+ Sbjct: 9 SATLELACELIRRPSVTPVDEGCQELMMRRLQALGFRIEPMRIEEVENFWASHGEQDGPV 68 Query: 63 FVFAGHTDVVPAGPLSQWHTPPFEPTV-IDGFLHGRGAADMKGSLACMIVAVERFIAEHP 121 FAGHTDVVP GPL W PF+ + G L GRGAADMKGSLA MI+AVERF+A+HP Sbjct: 69 LCFAGHTDVVPTGPLQAWQHQPFDALIDAQGMLCGRGAADMKGSLAAMIIAVERFVADHP 128 Query: 122 DHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRG 181 H+G I FLITSDEEGP +GT V+E L ARNE +D CIVGEPSST VGDVVKNGRRG Sbjct: 129 KHKGRIAFLITSDEEGPAQHGTKAVIERLAARNERLDWCIVGEPSSTALVGDVVKNGRRG 188 Query: 182 SITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAG 241 S+ L V+G QGHVAYPHLA NP+H A PALAELAA WD+GNA+FPPTSFQ+ NL AG Sbjct: 189 SLGATLTVRGVQGHVAYPHLARNPIHLAAPALAELAAEHWDDGNAFFPPTSFQVSNLNAG 248 Query: 242 TGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGE 301 TGA+NVIPGE FNFRFSTE T E +++RV ++LD HGLDY V+W LSG PFLT+ G Sbjct: 249 TGATNVIPGELRAVFNFRFSTESTVEGLQKRVEAILDRHGLDYHVEWALSGLPFLTEPGA 308 Query: 302 LLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADL 361 LL AV A+++ V + T+GGTSDGRFIA +G QVVELGPVNATIH++NE V +DL Sbjct: 309 LLDAVAASIKAVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATIHQINERVLASDL 368 Query: 362 EKLTDMYQKTLNHLL 376 E LT++Y +TL LL Sbjct: 369 EVLTEIYYQTLVKLL 383 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 384 Length adjustment: 30 Effective length of query: 347 Effective length of database: 354 Effective search space: 122838 Effective search space used: 122838 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_090443146.1 BLS63_RS09295 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.31125.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-167 541.9 0.0 4.1e-167 541.7 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090443146.1 BLS63_RS09295 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090443146.1 BLS63_RS09295 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 541.7 0.0 4.1e-167 4.1e-167 2 370 .] 12 382 .. 11 382 .. 0.98 Alignments for each domain: == domain 1 score: 541.7 bits; conditional E-value: 4.1e-167 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt.eepvlvfaGhtDvvPa 69 lela+eLi+r+svtP d+g+qel+++rL++lgf+ie +++e+++n+wa +g + pvl+faGhtDvvP+ lcl|NCBI__GCF_900100495.1:WP_090443146.1 12 LELACELIRRPSVTPVDEGCQELMMRRLQALGFRIEPMRIEEVENFWASHGEqDGPVLCFAGHTDVVPT 80 689***********************************************98578************** PP TIGR01246 70 GelekWssdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidG 137 G+l++W+ +pf++ + +G+l grGaaDmkgslaa+++a+erfv+++++hkG++++litsDeeg a +G lcl|NCBI__GCF_900100495.1:WP_090443146.1 81 GPLQAWQHQPFDALIdAQGMLCGRGAADMKGSLAAMIIAVERFVADHPKHKGRIAFLITSDEEGPAQHG 149 ***********9875279*************************************************** PP TIGR01246 138 tkkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavp 206 tk+v+e l +r+e +d+++vgePss+ +GDv+k+GrrGs+ ++l+++G+qGhvaYPh+a+nP+h a+p lcl|NCBI__GCF_900100495.1:WP_090443146.1 150 TKAVIERLAARNERLDWCIVGEPSSTALVGDVVKNGRRGSLGATLTVRGVQGHVAYPHLARNPIHLAAP 218 ********************************************************************* PP TIGR01246 207 vlkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkh 275 +l+el+a+++D+Gn+ffpp+s+q++n++agtga+nviPgel++ fn+rfs+e+++e l+++ve+ild+h lcl|NCBI__GCF_900100495.1:WP_090443146.1 219 ALAELAAEHWDDGNAFFPPTSFQVSNLNAGTGATNVIPGELRAVFNFRFSTESTVEGLQKRVEAILDRH 287 ********************************************************************* PP TIGR01246 276 kldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndti 344 +ldY++ew lsg pflt+ g l+++va++i+ v++++++ stsGGtsD+rfia+lg++vvelG+vn+ti lcl|NCBI__GCF_900100495.1:WP_090443146.1 288 GLDYHVEWALSGLPFLTEPGALLDAVAASIKAVTGRETTPSTSGGTSDGRFIATLGTQVVELGPVNATI 356 ********************************************************************* PP TIGR01246 345 hkvneavkiedleklsevyeklleel 370 h++ne+v +dle l+e+y+++l +l lcl|NCBI__GCF_900100495.1:WP_090443146.1 357 HQINERVLASDLEVLTEIYYQTLVKL 382 *********************99876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.67 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory