Align glutamate N-acetyltransferase/amino-acid acetyltransferase; EC 2.3.1.35 2.3.1.1 (characterized)
to candidate WP_090447626.1 BLS63_RS20395 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Query= CharProtDB::CH_000559 (406 letters) >NCBI__GCF_900100495.1:WP_090447626.1 Length = 405 Score = 389 bits (1000), Expect = e-113 Identities = 211/398 (53%), Positives = 271/398 (68%), Gaps = 7/398 (1%) Query: 13 LPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAVFTTNRFCAAPVHIAKSHLFDED 72 L + G L A AG+K+PG D+ ++ A G+ V VFT N FCAAPV +AK + Sbjct: 11 LHPVPGFELGIASAGIKRPGRKDVVVMRCAEGANVAGVFTLNAFCAAPVILAKKRVLGR- 69 Query: 73 GVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQVMPFSTGVILEPLPADKII 132 VR L+ NTGNANAGTG G ++A CA+ AR G V+PFSTGVI EPLP +KI Sbjct: 70 -VRYLLTNTGNANAGTGEPGLLNAARTCASLARLAGVDEGAVLPFSTGVIGEPLPVEKIE 128 Query: 133 ----AALPKMQPAFWNEAARAIMTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNM 188 AAL + W EAA IMTTDT+PK ASR+ V D TV TGI+KG+GMI PNM Sbjct: 129 GALQAALDDLAEDHWAEAASGIMTTDTLPKGASRQF-VHDGVTVTVTGISKGAGMIKPNM 187 Query: 189 ATMLGFIATDAKVSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEIDN 248 ATMLG+IATDAKV+Q VLQ + ++ A+++FN IT+DGDTSTND ++IATG+ + EI Sbjct: 188 ATMLGYIATDAKVAQGVLQDLLRDAANKSFNRITIDGDTSTNDCCMLIATGQAALPEITQ 247 Query: 249 IADPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAAYAAARSPL 308 + +A LK+ + + +E+AQAIVRDGEGATKF+TV+V T E YA A SPL Sbjct: 248 ASGALFAALKQAVFEVCMEVAQAIVRDGEGATKFVTVQVNGGATHQECLDVGYAVAHSPL 307 Query: 309 VKTAFFASDPNLGKRLAAIGYADVADLDTDLVEMYLDDILVAEHGGRAASYTEAQGQAVM 368 +KTA FASDPN G+ LAA+G A VA LD ++++L ++ +A G RAASYTE QG AVM Sbjct: 308 IKTALFASDPNWGRILAAVGRAGVAQLDVSKIDVFLGEVCIASRGCRAASYTEEQGAAVM 367 Query: 369 SKDEITVRIKLHRGQAAATVYTCDLSHGYVSINADYRS 406 + EIT+RI+L RG + T++T DLSH YV INA+YR+ Sbjct: 368 AAAEITIRIELGRGSCSETIWTTDLSHEYVKINAEYRT 405 Lambda K H 0.317 0.130 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 405 Length adjustment: 31 Effective length of query: 375 Effective length of database: 374 Effective search space: 140250 Effective search space used: 140250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory