Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate WP_090447976.1 BLS63_RS22185 alpha/beta hydrolase
Query= SwissProt::Q1J115 (336 letters) >NCBI__GCF_900100495.1:WP_090447976.1 Length = 339 Score = 48.1 bits (113), Expect = 3e-10 Identities = 75/267 (28%), Positives = 108/267 (40%), Gaps = 45/267 (16%) Query: 43 DVRVAYHTYGTPSDHAILVLHALTGTSAVHEWWPDFLGEGKPLDPTRDYIVCANVLGGCA 102 +V++AY + G SD +L++ L G +H WPD + + D I N G + Sbjct: 35 EVQLAYQSIGRTSDPVLLMVMGLGG-QLIH--WPDEV-VARLCDQGFRVIRFDNRDVGLS 90 Query: 103 GSTGPAELPRVNGE----------DPPLTLRDMARVGRALLEELGVRRVSVIGASMGGML 152 T A + E P LRDMA L++ LGVR+ V+GASMGGM+ Sbjct: 91 RWTHAAPPANLGYEALRYRLGLSVSAPYRLRDMAGDALGLMDALGVRQFHVLGASMGGMI 150 Query: 153 AYAWLLECPDLVDRAVII----GAPARHSPWAIGLNTAARNAIRAAPGGEGLKVARQIAM 208 A P V +I GA +P L A+ R AP +R++A+ Sbjct: 151 AQHLADLAPQRVQSLTLIMTSSGAAGLPAPSPALLELLAK---REAP-------SREVAL 200 Query: 209 LSYRSPESFALTQSGWGTRRPGTPDITTYLEHQGEKLSTRF-----CERSYLALTGAMDR 263 E A + G+ P D L Q E R +R LA+ R Sbjct: 201 ------EQQADLLAALGS--PAVSDDRQALLQQAETAYDRAFNPEGVQRQLLAILAEPSR 252 Query: 264 FQPTDAELRSIRVPVLVVGISSDVLYP 290 + L +R+P LVV ++D L P Sbjct: 253 VE----LLNRLRLPTLVVHGTADPLLP 275 Lambda K H 0.320 0.138 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 339 Length adjustment: 28 Effective length of query: 308 Effective length of database: 311 Effective search space: 95788 Effective search space used: 95788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory