Align 3-isopropylmalate dehydratase subunit LeuD (EC 4.2.1.33) (characterized)
to candidate WP_092052286.1 BQ4888_RS00460 3-isopropylmalate dehydratase
Query= ecocyc::LEUD-MONOMER (201 letters) >NCBI__GCF_900111775.1:WP_092052286.1 Length = 176 Score = 109 bits (273), Expect = 3e-29 Identities = 63/160 (39%), Positives = 95/160 (59%), Gaps = 16/160 (10%) Query: 10 GLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRF--LDEKGQQPNPDFVLNFPQ 67 G + LD ++++TD IIP ++L +VT+ ++ D + D KG++ Sbjct: 7 GPAIFLDRSDINTDEIIPAKYLTEVTKEALQPYMLEDLKLESFDPKGEK----------- 55 Query: 68 YQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDA 127 + A ++++RENFGCGSSREHAPW G +IA S+A IF N+FN +L ++L A Sbjct: 56 LKKARVVVSRENFGCGSSREHAPWVFEVNGVHTIIAQSYARIFRQNTFNGGMLAIELPKA 115 Query: 128 EVDELFALVKANPGIHFDVDLEAQEV--KAGEKTYRFTID 165 ++D LFAL KA + VDL+ Q+V KAGEKT F+ + Sbjct: 116 DLDRLFALDKAGE-VTISVDLDGQKVTAKAGEKTETFSFE 154 Lambda K H 0.322 0.138 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 102 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 176 Length adjustment: 20 Effective length of query: 181 Effective length of database: 156 Effective search space: 28236 Effective search space used: 28236 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory