Align Anthranilate phosphoribosyltransferase; EC 2.4.2.18 (characterized)
to candidate WP_092056124.1 BQ4888_RS07920 anthranilate phosphoribosyltransferase
Query= SwissProt::Q8PD71 (345 letters) >NCBI__GCF_900111775.1:WP_092056124.1 Length = 349 Score = 286 bits (732), Expect = 5e-82 Identities = 154/345 (44%), Positives = 215/345 (62%), Gaps = 12/345 (3%) Query: 8 ALQRTIEHREIFHDEMVDLMRQIMRGEVSDAMVSAILTGLRVKKETIGEIAGAATVMREF 67 A+ + +E +++ EM+ +M QIM GE + A ++A +T LR+K ET+ EI GAA VMR+ Sbjct: 5 AIAKIVERKDLTETEMIAVMDQIMGGEATPAQIAAFITALRMKGETVDEITGAARVMRDR 64 Query: 68 SRRVEV------------TDRRHMVDIVGTGGDGSHTFNISTCAMFVAAAGGAKVAKHGN 115 + + V D+ ++D+VGTGGDG++TFNIST FV AA G KVAKHGN Sbjct: 65 ATPIRVGKVLDIDREDINLDQETILDVVGTGGDGTNTFNISTTVSFVVAACGVKVAKHGN 124 Query: 116 RSVSSKSGSADALEALGAVIELQPEQVAASLAQTGIGFMYAPVHHPAMKVVAPVRREMGV 175 RSVSS GSAD LE LG +++ PE+V + + GIGF++AP H AMK R+E+G+ Sbjct: 125 RSVSSLCGSADVLEKLGVNLDVTPEKVEECIRELGIGFLFAPALHGAMKYAIGPRKEVGI 184 Query: 176 RTIFNILGPLTNPAGSPNILMGVFHPDLVGIQARVLQELGAERALVVWGRDGMDELSLGA 235 RTIFNILGPLTNPAG+ ++GV+ LV A+VL LG R VV+G DGMDE++L Sbjct: 185 RTIFNILGPLTNPAGADCQVLGVYQEALVEPLAQVLARLGCRRGFVVYGMDGMDEITLTG 244 Query: 236 GTLVGELRDGQVHEYEVHPEDFGIAMSASRNLKVADAAESRAMLLQVLDNVPGPALDIVA 295 T V E+RDG+V + + PEDFG++ L+ +A + ++ VL P D+V Sbjct: 245 PTRVAEIRDGKVKVFTIEPEDFGLSRCPMSALQGGNAVGNAEIVRSVLQGETSPRRDVVL 304 Query: 296 LNAGAALYVAGVADSIADGIVRARQVLADGSARACLDAYVAFTQQ 340 LNA AL AG A+ I G+ AR+ + +G A A +DA T + Sbjct: 305 LNAAYALVAAGAAEDIPAGLALAREAIDEGRALAKVDALAGMTNE 349 Lambda K H 0.320 0.134 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 311 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 349 Length adjustment: 29 Effective length of query: 316 Effective length of database: 320 Effective search space: 101120 Effective search space used: 101120 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_092056124.1 BQ4888_RS07920 (anthranilate phosphoribosyltransferase)
to HMM TIGR01245 (trpD: anthranilate phosphoribosyltransferase (EC 2.4.2.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01245.hmm # target sequence database: /tmp/gapView.8921.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01245 [M=330] Accession: TIGR01245 Description: trpD: anthranilate phosphoribosyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-131 422.4 0.9 1.6e-130 421.2 0.9 1.5 1 lcl|NCBI__GCF_900111775.1:WP_092056124.1 BQ4888_RS07920 anthranilate phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900111775.1:WP_092056124.1 BQ4888_RS07920 anthranilate phosphoribosyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 421.2 0.9 1.6e-130 1.6e-130 2 328 .. 7 344 .. 6 346 .. 0.95 Alignments for each domain: == domain 1 score: 421.2 bits; conditional E-value: 1.6e-130 TIGR01245 2 eklldnkdLseeeaeqlmkeimsgeasdaqiaAilvalrvkgeteeeiaglakalrekakkvekee... 67 k++++kdL+e+e+ ++m++im gea++aqiaA+++alr+kget++ei+g+a+++r++a+ +++ + lcl|NCBI__GCF_900111775.1:WP_092056124.1 7 AKIVERKDLTETEMIAVMDQIMGGEATPAQIAAFITALRMKGETVDEITGAARVMRDRATPIRVGKvld 75 799********************************************************9887532111 PP TIGR01245 68 .........seelvDivGTGGDglktiNiSTasalvaaaaGvkvaKhGnrsvssksGsaDvLealgvnl 127 +e ++D+vGTGGDg++t+NiST+ ++v+aa+GvkvaKhGnrsvss +GsaDvLe+lgvnl lcl|NCBI__GCF_900111775.1:WP_092056124.1 76 idredinldQETILDVVGTGGDGTNTFNISTTVSFVVAACGVKVAKHGNRSVSSLCGSADVLEKLGVNL 144 1112222226789******************************************************** PP TIGR01245 128 elspekvarsleevgigFlfAPkyhpalkevapvRkeLgvrtvfNlLGPLlnParaklqvlGvyskdlv 196 +++pekv+++++e+gigFlfAP+ h a+k++++ Rke+g+rt+fN+LGPL+nPa a+ qvlGvy++ lv lcl|NCBI__GCF_900111775.1:WP_092056124.1 145 DVTPEKVEECIRELGIGFLFAPALHGAMKYAIGPRKEVGIRTIFNILGPLTNPAGADCQVLGVYQEALV 213 ********************************************************************* PP TIGR01245 197 evlaevlknlgvkralvvhgedglDEisltgetkvaelkdgeieeytlspedfglkraeleelkggsae 265 e la+vl +lg +r +vv g dg+DEi+ltg+t+vae++dg+++ +t++pedfgl r+++++l+gg+a lcl|NCBI__GCF_900111775.1:WP_092056124.1 214 EPLAQVLARLGCRRGFVVYGMDGMDEITLTGPTRVAEIRDGKVKVFTIEPEDFGLSRCPMSALQGGNAV 282 ********************************************************************* PP TIGR01245 266 enaellkevlegkekkakrdivvlNaaaalyvagkakdlkegvelakeaiksgkalekleelv 328 nae++++vl+g+ +++rd+v+lNaa al++ag+a+d+ +g+ la+eai++g+al+k+++l+ lcl|NCBI__GCF_900111775.1:WP_092056124.1 283 GNAEIVRSVLQGET-SPRRDVVLLNAAYALVAAGAAEDIPAGLALAREAIDEGRALAKVDALA 344 ************99.889***************************************998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (349 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.03 # Mc/sec: 3.76 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory